KEGG   Tatumella citrea: A7K98_18500Help
Entry
A7K98_18500       CDS       T04873                                 

Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
tci  Tatumella citrea
Pathway
tci00071  Fatty acid degradation
tci00280  Valine, leucine and isoleucine degradation
tci00281  Geraniol degradation
tci00310  Lysine degradation
tci00362  Benzoate degradation
tci00380  Tryptophan metabolism
tci00410  beta-Alanine metabolism
tci00640  Propanoate metabolism
tci00650  Butanoate metabolism
tci00903  Limonene and pinene degradation
tci00930  Caprolactam degradation
tci01100  Metabolic pathways
tci01110  Biosynthesis of secondary metabolites
tci01120  Microbial metabolism in diverse environments
tci01130  Biosynthesis of antibiotics
tci01200  Carbon metabolism
tci01212  Fatty acid metabolism
Module
tci_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    A7K98_18500
   00650 Butanoate metabolism
    A7K98_18500
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A7K98_18500
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A7K98_18500
   00310 Lysine degradation
    A7K98_18500
   00380 Tryptophan metabolism
    A7K98_18500
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A7K98_18500
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    A7K98_18500
   00281 Geraniol degradation
    A7K98_18500
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A7K98_18500
   00930 Caprolactam degradation
    A7K98_18500
Enzymes [BR:tci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     A7K98_18500
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     A7K98_18500
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     A7K98_18500
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     A7K98_18500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ARU95547
UniProt: A0A1Y0LPV9
LinkDB All DBs
Position
3938932..3941124
Genome map
AA seq 730 aa AA seqDB search
MLYQGDTLTLSWLDDGIAMLEFNARGSVNTLDTGTILSLSAALDTLEALPDLRGLVLASA
KPAFIVGADINEFLSLFAAADQQIHQWLIFANQTFCRLEDLPVPTLSAINGYALGGGCEC
VLATDFRLVAPDARIGLPETRLGIIPGFGGTVRLPRLIGADSALEIITAGKDVDAQTALQ
LGLADAVVPADKLRTAAITILNEVSTDNYWQARRRQKLAALKLSPVEAAMSFTTAKALVR
QKAGPHYPAPVTAVKTIEAAAGMTRDDALTAERAAFIPLAKSETARALIGIFLNDQYVKG
LTRKKAAHATPPTQAAVLGAGIMGGGIAWQSARQGIPVKMKDLNQQALDSGITEATRLLS
EQQQRGKITPLQFAGILSAIHPTLDYAGFDQVDIVVEAVTENPQIKIKVLAETEQHLSED
ALLTSNTSTIPISLLARQLSRPQQFCGMHFFNPVPKMPLVEIIRGEQTAEPTIDRVIAWA
TALGKTPIVVNDCPGFFVNRVLFPYFAAFNLLLLDGADYRHIDKVMESEFGWPMGPSWLL
DVVGIDTAFHAQQVMAKGYPERMQIPDKDVISALFHAGRYGQKNRQGFWLWETDRKGKMK
KSADPQVNQLLAEVCAPSRLFTDEEILQRMMIPMINEVVRCLEENIIASPEEADMALVYG
LGFPAFRGGVFRYLDSQGSDKFLQQSLQFTELSPLYQAPALLTEKGRQQQSWYAPPAPIA
GPLNSDQGRA
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgctctatcagggcgatacccttaccctaagctggcttgatgatggcatcgccatgctg
gaatttaatgcccggggttcagtcaataccctggataccggaactatcctcagtttaagt
gccgcgctcgacacactcgaagccctgcctgatctcaggggcctggttttggcttctgca
aaacctgcgtttattgttggcgcagatattaatgagtttttgtctctgtttgcagccgct
gatcaacagattcaccaatggctgatattcgccaaccagacattttgtcgcctggaagac
ctgccagttcctaccctttcagcaattaacggttacgcccttggcggtggttgtgaatgt
gtactggcaaccgattttcgtctggtggctccggatgccagaatcggtttgccggaaacc
cggctgggaattatccccgggtttggtggtacggtgcggcttcccagactcatcggcgct
gacagtgctctggaaatcatcactgcaggtaaagatgttgatgcccaaactgcactgcaa
ctaggtcttgccgatgctgtcgtccctgcagataagctgcggaccgcagctatcaccata
ctaaatgaagtcagtacggataattactggcaggctcgtcgccgtcaaaaactggcagca
ttgaaactgagcccggtcgaggcagccatgagtttcaccacagccaaagcgctggtccgg
caaaaggcgggtccccactacccggctccggttacggcggtcaaaactatcgaggccgct
gcgggtatgacccgcgacgatgcattaaccgcagaaagagctgcttttatcccgctggca
aaatcggaaaccgcacgagcgttaattggcatttttctgaatgatcagtatgtcaaaggc
ctgacccgtaaaaaagcagctcacgcgactccacccacacaggcagcagtgctgggtgca
gggattatgggtggcggtattgcctggcaatctgcgcgacaaggtattccggtaaaaatg
aaagaccttaatcagcaggcgctggattcaggaatcaccgaagccacccggttattaagc
gaacaacagcagcgcgggaaaattacccccctgcagtttgccggtattttatcggcgatt
catccgacactggattatgccggttttgatcaggtggatattgtggttgaggccgttaca
gagaatccacaaattaagataaaagtgttggcagaaactgagcagcatctttcagaagat
gcactgctgacctccaatacttcaacgattcccatcagcctgttggcccgtcagctaagc
cggccgcagcagttttgcggtatgcatttttttaatccggtacccaaaatgccactggtt
gaaattatccgcggtgaacagacagctgaaccgactattgacagagtcattgcctgggct
actgccctcggaaaaacgccgattgtcgttaatgattgtccgggattttttgtaaaccgc
gtgctgttcccctatttcgccgcctttaacctgttgctgctggacggtgcagactacagg
catattgataaggtgatggaatcagagtttggctggccgatgggcccttcctggttactg
gatgtcgtgggaattgacacagcgttccatgctcagcaagtaatggcgaaaggttatccg
gaaagaatgcaaattcctgataaggatgtcattagtgcactgtttcatgccggacgctac
ggacaaaaaaatcgccagggattctggttatgggaaacagaccgcaaaggcaagatgaaa
aagagtgccgatccgcaagttaaccaattactggcagaggtctgtgccccttcacgcctg
tttactgatgaagaaatactgcaacggatgatgattccgatgatcaatgaagttgtgaga
tgtctggaagagaacatcatcgcctctccggaagaagctgatatggcgctggtttatggt
ctcgggttcccggcgtttcgcggcggtgttttccgttatctggacagtcagggctcagat
aaattcctgcaacagtccttacagtttaccgaattatcaccactgtatcaggctccggca
ttactaacagaaaaaggtcgtcagcagcaaagctggtatgcccctccggcgccgatagca
ggccccctgaattctgaccaagggagagcgtaa

DBGET integrated database retrieval system