KEGG   Tatumella citrea: A7K98_18945Help
Entry
A7K98_18945       CDS       T04873                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
tci  Tatumella citrea
Brite
Enzymes [BR:tci01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A7K98_18945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ARU95615
UniProt: A0A1Y0LCU7
LinkDB All DBs
Position
complement(4031661..4032278)
Genome map
AA seq 205 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDKETMEIHHTKHHQAYVNNANAALEGTEFAALPVEELITKL
DQVPADKKTALRNNAGGHANHSLFWKGLKTGTTLQGDLKAAIEKDFGSVDKFKEEFEKAA
ATRFGSGWAWLVKKGDKLAVVSTANQDSPLMGEAVAGVSGFPILGLDVWEHAYYLKFQNK
RPDYIKAFWNVVNWDEAAARFASAK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgagttattcactgccatccctgccttacgcttatgacgcgcttgagccgcatttcgat
aaggaaacgatggaaatccatcacaccaaacatcaccaggcttatgttaataacgccaat
gcagcacttgaaggtactgagtttgctgcactgccggtagaagaactgatcactaaactg
gatcaggttccggcggacaaaaaaaccgctctgcgcaacaatgccggtggtcacgctaac
cacagcctgttctggaaaggtctgaaaaccggaactaccctgcagggtgatctgaaagct
gcaatcgagaaagatttcggtagcgtagacaaattcaaagaagaatttgaaaaagctgct
gcaacccgctttggttccggctgggcgtggctggtgaaaaaaggtgataaactggcggtc
gtttctactgctaaccaggacagcccactgatgggtgaagctgtcgccggtgtttccggt
ttccctatcctgggtctggatgtgtgggagcacgcttattacctgaaattccagaacaaa
cgtcctgattacatcaaagcattctggaacgttgtaaactgggatgaagctgcagcgcgt
tttgcttcagcaaaataa

DBGET integrated database retrieval system