KEGG   Thauera chlorobenzoica: Tchl_0147Help
Entry
Tchl_0147         CDS       T04612                                 

Definition
(GenBank) Penicillin-binding protein 2 (PBP-2)
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
tcl  Thauera chlorobenzoica
Pathway
tcl00550  Peptidoglycan biosynthesis
tcl01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:tcl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Tchl_0147
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Tchl_0147
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tcl01011]
    Tchl_0147
Enzymes [BR:tcl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Tchl_0147
Peptidoglycan biosynthesis and degradation proteins [BR:tcl01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   Tchl_0147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: APR03023
UniProt: A0A1H5YLY6
LinkDB All DBs
Position
154333..156291
Genome map
AA seq 652 aa AA seqDB search
MTAFRAPAAELARFRLRVLAAAVFVLLCFGLLALRFYVLQVQRHDYFLTRAEDNRIALLP
VVPHRGAIIDRNGVVLARNYATYTLEITPSQVRDLDATLDELAALVPIEARDRRRFRKLL
EESRNFESVPLRSRLNDEEVARVVSQRYRLPGVDVKARLLRDYPQGSTAAHVLGYIGRIN
PRDIERIEERGETANYRGTQHIGKAGLEQSYEAELHGTTGVEQVEVNAGGRAVRALSRTP
AMPGNDLELTLDVELQRVAENAFGERRGALVAIEPATGGILALASMPSFDPNLFVDGIST
QDWKALNDSPDHPLLHRAIYSAYPPGSTFKPFMALAGLESGKRTAKQAIHDVGYFNFGSH
RFMDDKLGGHGMVDLHKSIVESCNTYYYQLANDLGIDGIAAFLAPFGFGARTGIDLPGEA
AGVLPSPQWKRERFRKAEQQRWYAGETISVGIGQGYNAYTPLQLANALAALVNDGRLFRP
HVVRHVVDPRSGARRVIEPAPLRQIPLRQAHLKSVLDAMVDVNRSGTGRRAFHGAPYTVG
GKTGTAQVFSLRGQRYVEGRVRERLRDHSWFVAYAPAENPRIALAVLVENGGFGAQSAAP
IARQVLDYYLLERRAAAPAKEDTESGEAVEDEAATVPAPPAAAPPDVSRSVP
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgttccgcgcgcctgccgccgaactcgcccgcttccgcctccgggttctggcg
gcggcggtcttcgtgctcttgtgtttcggcctgctcgcgctgcgcttctacgttcttcag
gtgcagcgccacgactacttcctcacccgcgccgaggacaaccgcatcgccctgctgccg
gtggtgccgcatcgcggcgccatcatcgatcgcaacggcgtcgtgctggcgcgcaattac
gccacctacacgctggagatcaccccctcgcaggtgcgcgatctcgatgccaccctcgat
gagctggccgcgctggtgccgatcgaggcgcgcgaccgccgccgctttcgcaagctcctc
gaagagagccgcaacttcgagagcgtgccgctgcgcagccgcctgaacgacgaggaggtc
gcccgcgtggtctcgcagcgctaccgcctgcccggcgtggacgtgaaggcgcgcctgctg
cgcgactatccccagggtagcaccgcggcgcatgtgctgggctacatcggccggatcaac
ccgcgcgacatcgaacgcatcgaggagcgcggcgagaccgccaactaccgcggcacccag
cacatcggcaaggccgggctggagcagtcctacgaggccgagctgcacggtaccaccggc
gtcgagcaggtcgaagtcaacgccggcggccgcgccgtgcgcgccctgtcgcgcacgccc
gcgatgcccggcaacgacctcgagctgacgctggacgtcgaactccagcgcgtcgccgag
aacgccttcggcgagcgtcgcggcgcgctggtggcgatcgagccggccaccggcggcatc
ctcgccctggcgtcgatgcccagcttcgaccccaacctgttcgtcgatggcatctccacc
caggactggaaggcgctcaatgactcgcccgaccatccgctgctccaccgcgcgatctat
tccgcctatccgccgggctccaccttcaagcccttcatggccctggccggcctcgagagc
ggcaagcgcacggcaaagcaggcgatccacgatgtcggctatttcaacttcggcagccac
cgcttcatggacgacaagctcggcggccacggcatggtcgacctgcacaagtcgatcgtc
gagtcgtgcaacacctactactaccagctcgccaacgatctgggcatcgacggcatcgcc
gccttcctggcgccgttcggcttcggcgcgcgcaccggcatcgacctgccgggcgaggcg
gccggcgtgctgccctcgccgcaatggaagcgcgagcgcttccgcaaggcggagcagcag
cgctggtacgccggcgagacgatctcggtgggcatcggccagggctacaacgcgtatacc
ccgctgcagcttgccaacgcgctggcggcgctggtcaacgacggcaggctgttccgcccg
cacgtggtccggcacgtggtcgacccgcgcagcggcgcgcggcgggtgatcgaacccgcg
ccgctgcgccagatcccgttgcgccaggcgcacctcaagtcggtgctcgacgcgatggtt
gacgtgaaccgcagcggcaccgggcgccgcgccttccacggcgcgccctacaccgtcggc
ggcaagaccggcaccgcccaggtgttttcgctgcgcggccagcgctacgtcgagggccgg
gtgcgtgagcgcctgcgcgaccattcctggttcgtcgcctacgctccggcggaaaacccg
cgcatcgccctcgccgtgctggtggagaacggcggtttcggcgcccagtcggcagcgccg
atcgcacgccaggtgctcgactactacctgctcgagcgccgcgccgcggctccggcgaag
gaggacacggaaagcggcgaggcggtggaggacgaagccgccaccgtgcctgcgccgccg
gctgccgcgccgcccgacgtttcccggagcgtgccgtga

DBGET integrated database retrieval system