KEGG   Thauera chlorobenzoica: Tchl_0150Help
Entry
Tchl_0150         CDS       T04612                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
tcl  Thauera chlorobenzoica
Pathway
tcl00550  Peptidoglycan biosynthesis
tcl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Tchl_0150
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tcl01002]
    Tchl_0150
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tcl01011]
    Tchl_0150
Enzymes [BR:tcl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Tchl_0150
Peptidases [BR:tcl01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   Tchl_0150
Peptidoglycan biosynthesis and degradation proteins [BR:tcl01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Tchl_0150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13 Transpeptidase
Motif
Other DBs
NCBI-ProteinID: APR03026
UniProt: A0A1H5YLU3
LinkDB All DBs
Position
158706..159833
Genome map
AA seq 375 aa AA seqDB search
MRFLIAVFVSLFSLGALAQSVPPPALAANAWVLIDHATGQTLAAKDPDARIEPASLTKLM
TAYLTFAAMKAGTITPEQVVPVSERAWRMEGSRMFIEPRKPVTVDELIKGVIVQSGNDAC
VALAELIAGSEEGFAALMNREAQRLGMVNTHFTNSTGLPDPQLYTTASDLARLASAIVRD
FPEYYSLYSMKEFTYNDIRQPNRNRLLYMDPTVDGMKTGHTSTAGYCLVSTAERGPRRLI
SVVLGAASDTVRAQESLKLLNYGFQFFETVKLYKADEALSQFRVWKGQLNELPVGFAQDF
VISLPKEAADKIQVTLESRQPLVAPLDKGQEVGTLTLTVDGKPAGQYPVVALQEVPVAGF
FGRLWDAIVMLFKQL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgcgctttctgatcgcggttttcgtttcactgttttccctgggcgcgctcgcgcagtcg
gtgccgccgccggcgctggccgccaacgcctgggtcctgatcgatcacgccaccggccag
accctggcggcgaaggaccccgatgcgcgcatcgagccggcttcgctgaccaagctgatg
accgcctacctgaccttcgccgcgatgaaggcgggcacgatcacgcccgagcaggtggtg
ccggtgtccgagcgcgcctggcgtatggaaggctcgcggatgttcatcgagccgcgcaag
ccggtgaccgtcgatgagctgatcaagggggtgatcgtgcagtcgggcaacgacgcctgc
gtcgccctggccgagttgatcgccggcagcgaagagggctttgccgcgctgatgaaccgc
gaagcccagcgcctggggatggtcaatacccacttcaccaactccaccggcctgcccgac
ccgcagctgtacaccactgccagcgacctcgcccgcctggccagtgcgatcgtgcgcgac
ttccccgagtactacagcctgtattcgatgaaggagttcacctacaacgacatccgccag
cccaaccgcaaccgcctgctgtacatggacccgaccgtcgatggcatgaaaaccggccac
accagcaccgccggctactgcctcgtgtccaccgccgagcgcggcccgcgccggctgatt
tcggtggtgctgggcgcggcctccgacaccgtgcgcgcgcaggagtcgctgaagctgctc
aactacggcttccagttcttcgaaacggtcaagctgtacaaggccgacgaggcgctgtcg
cagttccgggtgtggaaaggccagctcaacgagctgccggtcggcttcgcccaggacttc
gtgatctcgctgccgaaggaggcggcggacaagatccaggtcaccctggagagccgtcag
ccactggtggcgccgctcgacaagggccaggaggtcggcaccctgaccctgaccgtggat
ggcaagccggccggacagtacccggtggtggcgctgcaggaggtgccggtggcgggcttc
ttcggccgcctgtgggatgcgatcgtgatgctgttcaagcagctgtga

DBGET integrated database retrieval system