KEGG   Thauera chlorobenzoica: Tchl_0587Help
Entry
Tchl_0587         CDS       T04612                                 

Definition
(GenBank) Alkyl hydroperoxide reductase AhpF
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
tcl  Thauera chlorobenzoica
Brite
KEGG Orthology (KO) [BR:tcl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Tchl_0587
Enzymes [BR:tcl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Tchl_0587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 DAO FAD_oxidored AlaDh_PNT_C NAD_binding_8 NAD_binding_7 FAD_binding_3 FMO-like Thi4 K_oxygenase Glutaredoxin YojJ NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: APR03452
UniProt: A0A1H5XKR7
LinkDB All DBs
Position
597872..599440
Genome map
AA seq 522 aa AA seqDB search
MLDANIKTQLKAYLDKVTQPIELVASLDEGDKSGEMRALLGELAELSDKITVIESGAPGD
QAGERKPSFALARRGEPGRVRFAGLPMGHEFSSLILALLQVGGHPPKAAPELIEQIRALD
GEYVFETYISLSCHNCPEVVQALNLMAVLNPNIRHTMIDGALFQDEVEARKIMAVPTVLL
NGQPFGQGRMELGEILAKVDTGAAARDAGKLSAKDVFDVLVVGGGPAGAAAAIYAARKGI
RTGVVAERFGGQVMDTMAIENFISVKYTEGPKLVASLEEHVREYDVDVMNLQRVAQLVPG
EGVHEVKLDNGAVLKAKSVIVATGARWREMNVPGEREFRGKGVAYCPHCDGPLFKGKRVA
VIGGGNSGVEAAIDLAGVVAHVTLLEFADELRADAVLQKKLHSLPNVTVIKSAQTTEVTG
SDKVDGLVYKDRASGEVRRIELEGIFVQIGLLPNTDFAKGTLELTRFGEIIVDARGQTSV
PGIFAAGDCTTVPYKQIIIAMGEGAKASLSAFDHLIRSSAPA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaacatcaagactcaactcaaagcctacctggacaaggtcacgcagccg
atcgagctcgtcgcgtcgctcgacgagggcgacaagtcgggtgaaatgcgggccctgctc
ggcgagctcgccgagctcagcgacaagatcaccgtcatcgagtcgggcgcgcccggcgat
caggcgggcgagcgcaagccctcgtttgcgctcgcccgcaggggcgagccggggcgcgtg
cgctttgccgggctgccgatggggcacgagttcagctcgctgatcctggccctgctgcag
gtcggcggccatccgcccaaggccgcgcccgagctgatcgaacagatccgcgccctcgac
ggcgagtacgtgttcgagacctacatctcgttgtcctgccacaactgcccggaggtggtg
caggcgttgaacctgatggcggtgctcaaccccaacatccgccacaccatgatcgacggc
gcgctgttccaggacgaagtcgaggcgcgcaagatcatggcggtgccgacggtactcctc
aacggccagcccttcggccaggggcggatggagctgggcgagatcctggccaaggtcgac
accggcgccgcggcacgcgatgccgggaagctgtcggccaaggacgtcttcgacgtgctc
gtcgtcggcggtggcccggctggcgcggccgccgcgatctacgctgcgcgcaagggcatc
cgcaccggcgtcgtcgccgagcgcttcggcggtcaggtgatggatacgatggcgatcgag
aacttcatctcggtgaagtacaccgagggccccaagctggtcgccagcctcgaagagcac
gtccgcgagtacgacgtcgatgtcatgaacctgcagcgtgtcgcgcagctggtgccgggc
gagggcgtgcacgaggtgaagctcgacaacggcgccgtgctcaaggcgaagtccgtgatc
gtcgccaccggcgcgcgctggcgcgagatgaacgtgcccggcgagcgggagttccgcggc
aagggcgtggcctactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcg
gtgatcggcggcggcaactccggtgtcgaggccgcgatcgacctcgccggggtggtcgcc
cacgtcaccctgctcgagttcgccgacgagctgcgcgccgacgcggtgctgcagaagaag
ctccacagcctgcccaacgtgacggtgatcaagagcgcgcagaccaccgaagtgaccggc
agcgacaaggtggacggtctggtgtacaaggaccgcgccagtggcgaagtgcgccgtatc
gagctcgaaggcatcttcgtccagatcggcctgctgcccaataccgacttcgccaagggc
acgctcgagctcacccgtttcggcgagatcatcgtcgatgccaggggccagacttcggtg
ccgggcatcttcgccgccggcgactgcaccacggtgccgtacaagcagatcatcatcgcc
atgggcgaaggggcgaaggcttcgctgtcggccttcgatcacctgatccggagcagtgca
ccggcctga

DBGET integrated database retrieval system