KEGG   Thauera chlorobenzoica: Tchl_1915Help
Entry
Tchl_1915         CDS       T04612                                 

Definition
(GenBank) putative aldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tcl  Thauera chlorobenzoica
Pathway
tcl00030  Pentose phosphate pathway
tcl01100  Metabolic pathways
tcl01120  Microbial metabolism in diverse environments
tcl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tcl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Tchl_1915
Enzymes [BR:tcl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Tchl_1915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: APR04762
UniProt: A0A1H5X8V6
LinkDB All DBs
Position
2068029..2069876
Genome map
AA seq 615 aa AA seqDB search
MGWNRKILRVNLTAGSCTEEPLNMQWVQDYLGSRGLATKYLVSEIDPCVDPLSPANKMIM
ATGPLTGTMASTGGRYTVVTKGPLTGAIACSNSGGFFGAEMKFAGWDMVIFEGRSPKPVW
LYIENDRAELRDAAGLWGKSCWETEEQIRHVLQDPLVRVSSIGVAGENQVLFACIVNDLH
RAAGRSGVGAVMGSKNLKAVAIRGTKGVAGIRDFGAFLQATTAAKKVLADNAVTGQGLPR
YGTQVLMNVINEIGALPTRNHRDVQFEDASKISAEAMHEKRESDGKTHLVTNAACFGCTI
ACGRISEIDKGHFTVKNSPKYWGASGGLEYEAAWALGAANGVGDLEALQYANLICNEQGM
DPISFGATVGAAMELYEMGVLDDARIGLPAPFGSAEALAKLVEMTALGEGFGKELGLGSK
RLCEKYGHPELSMSVKGQEFPAYDARGIQGMGLAYATSNRGACHLRGYTVASEVMGIPLK
TDPHVTEGKAELVKAFQDATAVFDSAGICVFTSFAWTLADVQPQIAAACEGDWSMDKLNA
VGERIWNLERQFNNAAGLTAKDDTLPPRLTREPARTGPAKGMVNQLDKMLPQYYQVRGWT
PDGVPTAQTLQRLGL
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgggatggaatcgcaagatcctgcgggtgaacctcaccgccggcagctgtaccgaagag
ccgctgaacatgcagtgggtgcaggactacctcggctcgcgcggcctggccaccaagtac
ctggtgtccgagatcgacccttgcgtcgatccgctgtcgcccgccaacaagatgatcatg
gccaccggcccgctgaccggcaccatggcctccaccggcgggcgctacaccgtcgtcacc
aaggggcccctgaccggggcgatcgcctgttcgaactcgggcggtttcttcggtgccgaa
atgaagttcgccggttgggacatggtgatctttgagggccgctcgccgaagccggtctgg
ctctacatcgagaatgaccgggccgagctgcgcgatgccgccggcctgtggggcaagagc
tgctgggaaaccgaagagcagatccggcacgtgctgcaggacccgctggtgcgtgtgtcc
tcgattggcgtcgccggcgagaaccaggtgctgttcgcctgcatcgtcaatgacctgcac
cgcgctgccggacgctcgggggtgggcgcggtgatgggctcgaagaacctgaaggcggtg
gcgatccgcggcaccaagggggtggcgggcatccgggacttcggcgccttcctgcaggcc
accacggcggcaaagaaggtcctcgccgacaacgcggtcaccggccagggcctgcccagg
tacggcacccaggtgctgatgaacgtgatcaacgagatcggtgcgttgcccacgcgcaac
caccgtgacgtgcagttcgaggacgcctcgaagatctccgccgaggcgatgcacgagaag
cgcgagtccgacggcaagacccacctcgtcaccaacgccgcctgcttcggctgcacgatc
gcctgcggccgcatctccgagatcgacaagggccacttcacggtcaagaacagcccgaag
tactggggggcgtcgggcggcctcgagtacgaggcggcgtgggcgctcggtgcggccaac
ggcgttggcgacctcgaggcgctgcagtacgccaacctgatctgcaacgagcagggcatg
gacccgatctccttcggcgccaccgtcggcgcggcgatggagctctacgagatgggcgtg
ctcgacgacgcccggatcggcctgccggcccccttcggttccgccgaagcgttggcgaag
ctggttgagatgaccgcgctcggcgagggcttcggcaaggagctggggctgggcagcaag
cgcctgtgcgagaagtacggccaccccgagctgtcgatgagcgtgaaggggcaggaattc
cccgcctacgacgcgcgcggcatccagggcatgggcctcgcctacgccacctcgaaccgc
ggcgcctgccacctgcgcggttataccgtggcctccgaagtgatgggcattccgctcaag
accgacccccacgtcaccgaaggcaaggccgagctggtgaaggccttccaggatgcgacc
gcggtgttcgactcggccggcatctgcgtgttcaccagcttcgcgtggaccctggccgac
gtgcagccgcagatcgcggcggcgtgcgagggcgactggagcatggacaagctcaacgcg
gtcggcgagcgcatctggaacctggagcgccagttcaacaacgccgccggtctcaccgcc
aaggatgacaccctgccgccgcgcctgacccgggagccggccaggaccgggccggcgaag
gggatggtgaaccagctcgacaagatgctgccacagtactaccaggtgcgcgggtggacg
ccggacggcgtgcccaccgcgcagaccctgcagcgcctcggcctgtag

DBGET integrated database retrieval system