KEGG   Thauera chlorobenzoica: Tchl_2220Help
Entry
Tchl_2220         CDS       T04612                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
tcl  Thauera chlorobenzoica
Pathway
tcl00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:tcl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Tchl_2220
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tcl02000]
    Tchl_2220
Enzymes [BR:tcl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Tchl_2220
Transporters [BR:tcl02000]
 Other Transporters
  Pores ion channels [TC:1]
   Tchl_2220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_2 GST_N_3 GST_C_2 Tom37
Motif
Other DBs
NCBI-ProteinID: APR05060
UniProt: A0A1H5S115
LinkDB All DBs
Position
complement(2401292..2401897)
Genome map
AA seq 201 aa AA seqDB search
MKLYIKPGACSLTPHIVLEEAGLPYTTETVDLGTRRTAGGADYTTINPKGYVPALQLDSG
EVLTELPAIVQYLADLAPEKKLAPANGTLERYRLQSWLGFIGTEVHKSFSPFFNPAAGDD
WKQAARANLERRLGYADSQLAGRAYLLGEDFSVADAYLFTVLSWAKYIGLDLAPWPNVTA
CLDRVAARPAVRAALKAEGLV
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtacatcaagcccggcgcctgctcgctgaccccgcacatcgtgctcgaggaa
gccggccttccctacactaccgaaaccgtcgatctcggcacccggcgcaccgccggcggt
gcggactacaccacgatcaaccccaagggctacgtaccggcgctgcagctcgacagcggc
gaagtgctgaccgagctgccggcgatcgtccagtacctggccgatctcgcccccgaaaag
aagctcgcgccggccaacggcacgctcgaacgctaccgcctgcaaagctggctgggcttc
atcggcaccgaggtgcacaagtccttcagccccttcttcaatccggccgcgggggacgac
tggaaacaggccgcacgcgccaacctcgagcgccgcctcggctacgccgacagccagctc
gccggccgcgcctatctgctgggggaggatttcagcgtcgccgacgcctatctgttcacc
gtgctgagctgggcgaaatacatcggcctcgatctcgcgccctggccgaacgtcaccgcc
tgcctggaccgcgtcgccgcgcgcccggcggtgcgcgccgcgctgaaggcggaagggctg
gtctaa

DBGET integrated database retrieval system