KEGG   Thauera chlorobenzoica: Tchl_2761Help
Entry
Tchl_2761         CDS       T04612                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
tcl  Thauera chlorobenzoica
Pathway
tcl00061  Fatty acid biosynthesis
tcl00780  Biotin metabolism
tcl01100  Metabolic pathways
tcl01212  Fatty acid metabolism
Module
tcl_M00083  Fatty acid biosynthesis, elongation
tcl_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:tcl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Tchl_2761
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Tchl_2761
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:tcl01004]
    Tchl_2761
Enzymes [BR:tcl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     Tchl_2761
Lipid biosynthesis proteins [BR:tcl01004]
 Fatty acid synthase
  Component type
   Tchl_2761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH AfsA CDC48_2
Motif
Other DBs
NCBI-ProteinID: APR05584
UniProt: A0A1H5X3N7
LinkDB All DBs
Position
complement(2986644..2987078)
Genome map
AA seq 144 aa AA seqDB search
MNINEIIEYLPHRYPFLLIDRVLEIEEGKRIKALKNVTMNEPFFPGHFPHHPVMPGVLIV
EAMAQAAAVLSFKSMGVKPDENSVVYFAGIDNVRFKRPVVPGDQLIFDVEITQSKRNIYK
YKGVARVDGDVATEAELMCALKTL
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcaacgaaatcatcgagtacctgccgcatcgctatcccttcctgctgatcgac
cgggtgctcgagatcgaagaaggcaagcgcatcaaggcgctgaagaacgtgaccatgaac
gagcctttctttccggggcattttccccatcacccggtgatgcccggggtgctgatcgtc
gaggcgatggcccaggccgctgcggtgctgtcgttcaagagcatgggggtcaagcccgac
gaaaactccgtggtgtacttcgccggcatcgacaacgtccgcttcaagcgcccggtggtg
ccgggcgaccagctgatcttcgacgtcgagatcacccagagcaagcgcaatatctacaag
tacaagggcgtggcccgcgtcgatggcgacgtcgcgaccgaggccgagctgatgtgcgcg
ctgaagaccctatga

DBGET integrated database retrieval system