KEGG   Thermodesulfobacterium commune: HL41_02390Help
Entry
HL41_02390        CDS       T03212                                 

Definition
(GenBank) aldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tcm  Thermodesulfobacterium commune
Pathway
tcm00030  Pentose phosphate pathway
tcm01100  Metabolic pathways
tcm01120  Microbial metabolism in diverse environments
tcm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HL41_02390
Enzymes [BR:tcm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     HL41_02390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AIH03733
UniProt: A0A075WTL7
LinkDB All DBs
Position
complement(452314..454113)
Genome map
AA seq 599 aa AA seqDB search
MYGYAGKILRINLTNQTIKVEDLNAEWAKKYIGGRGLASKYLYEEIDPKVDPFSPENKLI
ITTGPLTGTSVPTGGRYMVVTKSPLTGAIACSNSGGFFGAELKAAGYDMIILEGKAPKPV
YITIEDDKVEIKDATHLWGKLVYETTDLLKQEYGDKAKVLAIGPAGEKLVRIAAVMNDYD
RAAGRSGVGAVMGSKNVKAIVAKGSKGVSVADEQKVKDVVASKIKIIRENPVTGEGLPAY
GTAILVNIINEHGIFPVANFQKAYTPEADKISGETMAKTILTKKHACFRCPIACGRVVRL
KDGKEVGGPEYETVWSYGANCEVYDLNAISEANYWCNQYGLDTISTGATIAAAMELYQKG
YIKDDEIAKDGLSLKFGDPEAIVGWTIKIGKREGLGDKLAEGSYRLCEAYGAPDLSMSVK
KQELPAYDPRGVQGHGLVYATANRGGCHVRGYLISAEILGIPQKLDRFSTEGKAEWAKIF
QDLTAVIDSLGMCLFTSFALGLKDYVDLMNAVCGTDYTEETLLAAGERIYNLERLFNLKA
GIDPSQDTLPKRLLEEPIPEGPSKGAVHKLSELLPKYYEVRGWDEKGYPKEETLKRLEI
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgtacgggtatgctgggaaaattttaagaattaacctcaccaatcaaaccattaaggtt
gaagatttaaatgctgaatgggctaagaagtatattggaggaagagggcttgcgagtaag
tatttatatgaggaaatagaccctaaagtagacccctttagccctgaaaacaagttgata
attactacaggtcctcttaccggtacctctgtccctacaggtggaagatatatggtggtt
actaaatctcctctgacaggggccatagcttgttctaactccggaggtttttttggtgct
gaacttaaagctgctggttatgacatgataatccttgaaggtaaagctcccaaaccagtc
tatatcaccatagaagacgataaggttgagataaaggatgctacccatctctggggaaag
ttagtttatgaaactaccgaccttttaaaacaagaatatggagataaggccaaagtcctt
gcgataggaccagcaggggaaaaattagtaaggatcgctgcggtgatgaacgattatgat
agagcagcaggaaggtctggagtgggtgctgttatggggtctaaaaacgtaaaagctata
gtagccaaaggtagtaagggtgtttctgtggctgacgaacaaaaagtaaaagatgtagta
gcaagcaagataaaaatcattcgtgaaaaccctgtaactggagaaggacttcctgcctac
ggaacagccatcttggtaaacataataaacgaacatggtatctttcctgtggctaacttt
caaaaagcctatacccctgaggctgataagataagtggagaaaccatggctaaaactatt
ttaactaaaaaacatgcctgttttagatgtcctatagcctgtggaagggtggtaaggtta
aaagacggaaaagaggttggtgggcctgagtatgaaactgtatggtcttatggagccaac
tgtgaggtttatgacttaaatgctatttctgaggctaactactggtgtaatcagtatggg
ttagacaccatctctacaggtgctaccatagcagctgctatggaactttatcaaaaagga
tacatcaaagacgatgagatagctaaagatggattatctcttaagtttggagacccagaa
gcaatcgtaggctggacgataaagataggaaaaagagaaggattaggagataaattggca
gaaggttcttacaggttgtgcgaggcctacggtgctcccgacctttctatgagtgttaaa
aaacaagaattacctgcctatgacccaagaggggttcaaggacatggtttggtttatgcc
acagccaacagaggtggatgccatgtgagaggataccttatctctgctgaaattttaggt
attcctcaaaaacttgacaggttctctacagaaggcaaagctgaatgggcaaaaattttc
caggacctgactgcagttatagattctcttgggatgtgccttttcacctcttttgcttta
gggcttaaagactatgtagaccttatgaatgccgtttgtggtactgactacacagaagaa
acccttcttgctgcaggagaaagaatctataatttagaaagactatttaacctaaaagcc
ggtatagacccatctcaagatacccttcccaagaggttgcttgaagaaccaatccctgaa
ggcccttcaaaaggtgcagtacataagctttcagagctgttacctaaatactacgaggta
agaggttgggacgaaaaaggttatcctaaggaagaaaccctaaaaagattagaaatctaa

DBGET integrated database retrieval system