KEGG   Thermobacillus composti: Theco_0339Help
Entry
Theco_0339        CDS       T02394                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
tco  Thermobacillus composti
Pathway
tco00620  Pyruvate metabolism
tco00680  Methane metabolism
tco01100  Metabolic pathways
tco01120  Microbial metabolism in diverse environments
tco01200  Carbon metabolism
Module
tco_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:tco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Theco_0339
  09102 Energy metabolism
   00680 Methane metabolism
    Theco_0339
Enzymes [BR:tco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Theco_0339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AGA56567
UniProt: L0E9V1
LinkDB All DBs
Position
343547..346354
Genome map
AA seq 935 aa AA seqDB search
MSDQAATQTAQSRPQVSSLLRRDVRYLGNILGEVLVHQGGQQLLEVVERIREMSKTLRAS
FDPKLHEEFKQLVESLNPEIRHQVIRAFAIYFQLVNIAEQIHRIRRKRDYERSAGAAVQP
GSIESAVKDLKERGVPVEIVREMIKGISLELVMTAHPTEATRRAVLDIHKRMACDVLELD
NPTLTNRERERLRDKLLNEVLTLWQTDELRSRKPTVLDEVQNGLFYFDQTLFDVLPDVYE
ELERCLDKYYPGERWHVPTYLRFGSWIGGDRDGNPSCTSDVTWETFNRHRHLTVSKYRAE
LRKLMSLLSFSTSIVKVSEELIESIRRDCEAIGDLANLDRWRNDKEPYRIKIGYMLQKLA
NMKREELKGTPARYNSAEELKQDLKIIDRSLRYHFADYVADTHIRKLIRQVELFGFHLTT
LDIRQHSKEHENAIAEILAKMKITPDYAALDEEEKIRLLDQLLNDPRPLTSPHIEYSDST
RECLNVFHTVYRAQQEFGVDCVRSYLISMTQGASDMLEVLLFAKEVGLFRRDEDGKVVCT
LQPVPLFETIDDLHAAPGIMQRVFDLPIYRASVEAMGQLQEIMLGYSDSNKDGGVVTANW
ELRVALNEITETGNRYGVKLKFFHGRGGALGRGGMPLNYSILAQPPHTIGGGIKITEQGE
VLSSRYAMQGIAYRSLEQATSALITAARLAKYPEQNSDKNAEYESIAKELSERAMKKYQD
LIFRDPDFLTFFKESTPLNEIGELNIGSRPSKRKNSDRFEDLRAIPWVFAWTQSRFLLPA
WYAAGTAMAEYVGGDEAKLDKLRRAYVEFPFFRTLIDNLQMALAKADMHIAKEYAGMIKD
PAIRDRIFGMIEREYELTTEMILRVTGQKEILDNVPIIQESIRLRNPYVDPLSYLQVQLL
TELRALRVRGEDDPHLLREVLLTINGIAAGLRNTG
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatcaagccgcaacccaaacggctcagagccgcccccaggtcagcagcctgctg
aggcgggatgtccgctatctgggcaatatcctgggtgaagtgctcgtgcaccagggcgga
cagcagctgctcgaagtcgtcgaacgcatccgcgagatgagcaagacactccgcgcgtcg
ttcgacccgaagctgcatgaggagttcaaacagctcgtggaatcgctcaatccggagatt
cggcatcaggtgatccgggcgttcgcgatttattttcagctcgtcaatattgcggaacag
attcaccggattcggcgcaagcgggattatgagcgttcggcgggcgcagccgtgcagccg
ggctccatcgagagcgcagtgaaggatctgaaggaacgcggcgttccggtcgagatcgtt
cgggaaatgatcaaaggcatttcgctcgagcttgtcatgaccgcgcatccgaccgaggcg
acaagacgcgccgtgctcgacattcacaaacggatggcctgcgacgtgctggaactggac
aatccgacgctgacgaaccgcgagcgcgagcgtctgcgggacaaactgctcaacgaagtg
ctgaccctctggcagacggacgagcttcgcagccgcaagccgaccgtcctcgacgaagtg
cagaacgggctgttctatttcgatcagacgctgttcgatgtgctgcctgacgtctatgag
gagctggagcgctgcctggacaaatattatccgggcgaacgctggcatgtgccgacgtat
ctccgcttcggttcgtggatcggcggcgaccgggacggcaatccgtcctgcacgtcggat
gtaacgtgggagacgttcaaccggcatcgtcaccttacggtgtcgaagtaccgcgcggaa
ctgcgcaagctgatgtcgctgctcagcttcagcacgagcatcgtgaaggtgtcggaagag
ctgatcgagtcgatccgccgggattgcgaggcgatcggagatctggcgaacctggaccgg
tggcgcaacgacaaggagccgtaccggatcaagatcggctatatgctgcagaagctggcg
aacatgaagcgcgaagagctgaaaggcacgccggcccgctacaacagcgccgaggaactg
aagcaggatctgaagatcatcgaccggagcctgcgctaccatttcgccgattatgtcgcc
gatacccatatccgcaagctgatccgccaggtggaactcttcggtttccatctgacgacg
ctcgatattcgccagcacagcaaggagcatgagaatgcgattgcggagattctggcgaaa
atgaagataacgccggattatgcggcgctggatgaagaagagaaaatccggctgctggat
cagctgctgaacgatccgcggccgctgacgtcgccgcatatcgagtattcggattcaacc
cgcgaatgtctgaacgtcttccacaccgtctatcgcgcgcagcaggaattcggcgtggac
tgtgtgcgcagctacctgatcagcatgacgcagggcgcgagcgacatgcttgaagtgctg
ctgttcgccaaggaagtcggcctgttccgccgggacgaggacggcaaggtcgtctgcacg
ctgcagccggtgccgctgttcgagacgatcgacgacctgcatgccgcgccggggatcatg
cagcgcgtcttcgatctgccgatttaccgcgcatccgtcgaagcgatggggcagctgcag
gaaatcatgctcggctactccgacagcaacaaggatggcggcgtcgtgacggcgaactgg
gagctgcgcgtcgcgctgaacgagatcacggagacgggcaatcgctacggcgtgaagctg
aaattcttccacggccggggcggcgcgctcggacgcggcggcatgccgctcaattacagc
attctcgcgcaaccgccgcatacgatcggcggaggcatcaagattacggagcagggcgag
gtgctttcgtcccgctacgcgatgcaaggcatcgcctaccgcagcctcgagcaggcgacc
agcgcgctgatcaccgcggcccggctcgcgaagtatcccgagcagaacagcgacaagaac
gcggagtacgagtcgatcgcgaaggaactgtcggaacgggcgatgaagaagtatcaggat
ctcattttccgcgatccggacttcctgacgttcttcaaggagtcgaccccgctgaacgag
atcggcgagctgaacatcggttcacggccttcgaagcggaagaacagcgaccgtttcgaa
gatttgcgcgccattccgtgggtgttcgcctggacgcagagccgtttcctgctgccggcc
tggtacgccgcgggcacggcgatggcggagtatgtcggcggcgacgaggcgaagctggat
aagctgcgccgcgcctatgtggagtttccgttcttccgcacgctgatcgacaacctgcag
atggcgctggccaaggccgacatgcatattgccaaagagtatgccggcatgatcaaggat
ccggccattcgggaccgcatcttcggcatgatcgaacgggaatacgagctgacgaccgag
atgatcctgcgcgtgacgggccagaaggaaattctggacaacgtgccgatcattcaggaa
tcgatccggctgcgcaatccgtacgtcgatccgctcagctatcttcaagtgcagctgctc
accgaactgcgcgcgctgcgcgtccgcggggaagacgatccccatctgctgcgcgaagtg
ctgctgacgatcaacggcattgcggccggtctccggaatacgggctga

DBGET integrated database retrieval system