KEGG   Thermobacillus composti: Theco_2932Help
Entry
Theco_2932        CDS       T02394                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
tco  Thermobacillus composti
Pathway
tco00473  D-Alanine metabolism
tco01100  Metabolic pathways
tco01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tco00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Theco_2932
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Theco_2932
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tco01011]
    Theco_2932
Enzymes [BR:tco01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Theco_2932
Peptidoglycan biosynthesis and degradation proteins [BR:tco01011]
 Precursor biosynthesis
  Racemase
   Theco_2932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AGA58999
UniProt: L0EH93
LinkDB All DBs
Position
complement(3058308..3059486)
Genome map
AA seq 392 aa AA seqDB search
MDTYYRPTRAEISLDALSRNIAAFRRALAPGTKLMASVKANAYGHGAVEIARESVSAGAD
MLGVAFLDEAVQLRRGGIEAPILVLGYVPPEGFSVARELDISVAMFREDALEAAARPGTR
PLRVHVKVDTGMGRLGVLPEEAVRFVERAMRTPGVEVEGLFTHFARADEADKSYTRLQHE
RFAAVTEAVRRRGLDIPLIHLGNSAAGIDTPEWTGGMLRLGIGMYGLYPSAEVGKTRIEL
EPVLTLKTEIVMTKTAPPGWGISYGTRYVTRGEERIGTLPIGYADGYSRMLTGKAEALVR
GVRVPVLGTICMDQCMIALGPADRAEGFGSPVEAGEEVVLIGRQGDEVITADEIASLLGT
INYEIVCMLAARVPRVYIRGGKPVEVRNGLAG
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggacacatattatcgaccgacccgcgcggaaatttcgctggatgcactgagccggaac
atcgcggcgttccggcgggcgcttgcgcccggaacgaagcttatggcttccgtgaaggcg
aacgcctacggccacggagccgtcgagattgcgcgggagtcggtctcggcaggcgcggac
atgctcggcgtcgcgtttctcgacgaggcggtgcagctccgccgcggagggatagaggcg
ccgattctcgtgcttgggtatgtgccgcccgagggcttctccgtcgcccgcgaattggac
atatcggtcgccatgttccgcgaagacgcgctggaagcggcggcgcggcccggcacgcgt
ccgctgcgcgtgcacgtcaaggtggacaccggcatgggccggctcggggtgctgccggag
gaagcggtccggttcgtcgagcgggccatgcgcacgccgggcgtcgaagtggaagggctg
ttcacccacttcgcacgcgcggatgaagcggacaaatcctacacccgcctgcagcacgag
cggttcgccgccgtgacggaagccgtgcgccgccgcggactcgacatcccgctcattcat
ctcggcaacagcgcggcgggcatcgacacgccggaatggacgggcggcatgctgcggctc
ggcatcggcatgtacggcctctatccgtccgcggaagtcgggaaaacgcggatcgagctg
gagccggtcctgacgctgaagaccgaaatcgtgatgacgaagaccgcgccgcccgggtgg
ggcatcagctacggcacgcgctatgtgacgcgcggcgaagagcggatcggcacgctgccg
atcggctacgcggacgggtacagccggatgctgaccggcaaggcggaggcgctggtgcgc
ggcgtccgcgtacccgtgctcggcacgatctgcatggatcaatgcatgatcgcgctggga
ccggcggatcgggcggaagggttcggcagcccggtggaggccggggaagaagtcgttctc
atcggacggcagggcgatgaggtcatcacggccgacgaaatcgcgtcgctgctcggtacg
atcaactacgaaatcgtctgcatgctcgccgcccgggtgccccgggtctatatccgcggc
ggcaagccggtggaagtgcggaacggacttgccggatga

DBGET integrated database retrieval system