KEGG   Thermobacillus composti: Theco_3029Help
Entry
Theco_3029        CDS       T02394                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
tco  Thermobacillus composti
Pathway
tco00473  D-Alanine metabolism
tco00550  Peptidoglycan biosynthesis
tco01100  Metabolic pathways
tco01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tco00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Theco_3029
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Theco_3029
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Theco_3029
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tco01011]
    Theco_3029
Enzymes [BR:tco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Theco_3029
Peptidoglycan biosynthesis and degradation proteins [BR:tco01011]
 Precursor biosynthesis
  Amino acid ligase
   Theco_3029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AGA59089
UniProt: L0EHI1
LinkDB All DBs
Position
complement(3166568..3167728)
Genome map
AA seq 386 aa AA seqDB search
MGDKVRVGLVYGGRSGEHEVSLQTAFSVLQAFDYDKYEIQPFYITKQGIWHAGPALSAPP
EHIGLIRYDEADGSASEQLLLPVFERMAAPPKAPAAAAKAVQKAAPSASSGGSGGKRLDV
VFPLLHGTYGEDGTIQGLLEMAGIPYVGAGVLASAVGMDKVMMKRVFAHEGLPQCVFRHF
TRAQWDKDAQYFIMEIEVSLGYPCFVKPANLGSSVGISKAYNREQLIQAVEYAFRYDRKV
LVEEFVNARELEVSVLGNDEPRASVVGEIVSSNDFYDYNAKYIDGKSVMKIPADIPEETA
EQIREMALRAYQAIDGSGLARVDFFLRKEDGRIFLNEVNTMPGFTPFSMYPLLWKESGLP
YRELLDKLIALAFERHEAKQKLVYGE
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgggggataaagttcgggtagggctcgtctacggcggccgttccggagaacatgaggtg
tcgctgcagaccgcgttctccgtgctgcaagcattcgattacgacaaatatgaaatccag
ccattctatattacgaagcagggcatctggcatgccgggccggcgctgtcggctccgccg
gaacatatcggcctcatccgttacgacgaagcggacggatccgcgtcggaacagctgctg
ctgcccgtgttcgaacggatggccgctccgcccaaggcgccggctgcagccgcgaaggcg
gttcagaaagccgcgccttcggcatcgtcgggcggcagcggcggcaagcggctggatgtc
gtctttccgctgctgcacgggacgtacggcgaggacggcacgatccaggggctgctggaa
atggcgggcattccgtatgtcggcgcgggcgtgcttgcttcggctgtcggcatggacaag
gtcatgatgaagcgggtgttcgcccatgaagggctgccgcagtgcgtgttccggcatttc
acccgggcgcagtgggacaaggatgcgcaatatttcatcatggagatcgaggtgtcgctc
ggctacccttgcttcgtcaagccggccaacctcggttcgagcgtcggcatctcgaaggcc
tacaaccgcgagcagctgatccaggcggtggaatatgcgttccgttacgaccgcaaggtg
ctcgtcgaagaattcgtgaacgccagggagctggaagtgagcgtgctcggcaacgacgag
ccccgcgcgtcggtcgtcggggagattgtctcgtcgaacgacttctatgactacaacgcg
aaatatatcgacggcaaatccgtcatgaagattccggccgacatcccggaggagacggcc
gaacagatccgcgagatggcgcttcgcgcctatcaggcgatcgacggatcgggccttgcg
cgcgtcgacttcttcctgcgcaaggaagacggccgcatcttcctgaacgaagtgaacacg
atgccgggatttacgccgttcagcatgtacccgctgctctggaaggagtcggggctgccc
tatcgggaactgctcgacaagctgatcgcgctcgcgttcgagcggcatgaagcgaagcag
aagctcgtctacggcgaataa

DBGET integrated database retrieval system