KEGG   Trypanosoma cruzi: 506399.89Help
Entry
506399.89         CDS       T01012                                 

Definition
(RefSeq) succinate dehydrogenase flavoprotein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
tcr  Trypanosoma cruzi
Pathway
tcr00020  Citrate cycle (TCA cycle)
tcr00190  Oxidative phosphorylation
tcr01100  Metabolic pathways
tcr01110  Biosynthesis of secondary metabolites
tcr01130  Biosynthesis of antibiotics
tcr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tcr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    506399.89
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    506399.89
Enzymes [BR:tcr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     506399.89
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Pyr_redox_2 HI0933_like DAO GIDA Thi4 FAD_binding_3 Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 3539871
NCBI-ProteinID: XP_809281
GeneDB: Tc00.1047053506399.89
UniProt: Q4D4H1
LinkDB All DBs
AA seq 167 aa AA seqDB search
MLRRIFARFSPKLSKAYPMIDHTFDCVVVGAGGSGLRAAMGVAASGYDVACISKLYPSRS
HTIAAQGGINAALANCEEDDWRWHVYDTVKGSDWLGDQDAIQYMCQEAPCVVSELESMGL
PFLRTKDGFIYQRAFGGQSIHFGGKQARRTCAASDRTGHAMLHTLYG
NT seq 503 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgccgcatatttgcccgcttctccccgaagctgagtaaggcgtacccgatgatt
gaccacacctttgactgtgtggtggttggtgccggtggttcagggcttcgtgctgcgatg
ggcgttgccgcgtccggctacgacgtggcatgcatctctaaactctatccatcaaggtca
cacaccattgctgcccagggcggcatcaacgcagcacttgccaactgtgaggaggacgac
tggcgttggcatgtgtacgataccgtgaagggaagtgactggctgggggatcaggatgca
attcagtacatgtgccaagaagctccgtgtgtggtctcagaactagagagcatgggactt
cccttcttgcgtacaaaagatggatttatttatcaacgtgcatttggcggccaatctatt
cactttggtggaaaacaggcgcgccggacgtgtgccgcgtcggaccgcacgggacacgca
atgctccacacactctatgggca

DBGET integrated database retrieval system