KEGG   Trypanosoma cruzi: 507241.30Help
Entry
507241.30         CDS       T01012                                 

Definition
(RefSeq) arginine kinase
  KO
K00934  arginine kinase [EC:2.7.3.3]
Organism
tcr  Trypanosoma cruzi
Pathway
tcr00330  Arginine and proline metabolism
Brite
KEGG Orthology (KO) [BR:tcr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    507241.30
Enzymes [BR:tcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.3  arginine kinase
     507241.30
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN
Motif
Other DBs
NCBI-GeneID: 3536410
NCBI-ProteinID: XP_806409
GeneDB: Tc00.1047053507241.30
UniProt: Q4CWA5
LinkDB All DBs
Structure
PDB: 

AA seq 357 aa AA seqDB search
MASAEVVSKLEAAFAKLQNASDCHSLLKKYLTKEVFDQLKGKQTKMGATLMDVIQSGVEN
LDSGIGVYAPDAESYTLFAALFDPIIEDYHKGFKPSDKQPPKDFGDLNTFIDVDPDKKYV
ISTRVRCGRSLEGYPFNPCLKKQQYEEMESRVKGQLESMSGELRGKYYPLTGMTKETQKQ
LIDDHFLFKEGDRFLQAAHACEFWPTGRGIYHNDAKTFLVWVNEEDHLRIISMQKGGNLK
EVFGRLVTAVGVIEEKVKFSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLGADRKKLEEV
AAKYNLQVRGTAGEHSDSPDGVYDISNKRRLGLSEYEAVKEMQDGILELIKAEESAR
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcctccgcggaagttgtcagcaaacttgaggcggcgttcgccaaactgcagaacgca
agcgactgccactcgctcctcaagaagtacctcacgaaggaggtgtttgaccagctgaag
gggaagcagacgaaaatgggcgccacgctcatggacgtcatccagtcgggcgtggagaac
ctggactctggcattggcgtgtacgcgcccgacgccgagtcgtacaccttgttcgccgcc
ctcttcgacccgatcatcgaggactaccacaagggcttcaagccaagcgacaagcagccc
ccgaaggactttggtgatctcaacacgttcattgacgtggaccctgacaaaaaatacgtc
atctccacacgcgtgcgctgcggccggagccttgagggctacccgttcaatccctgtctc
aagaagcagcagtatgaggagatggagtcgcgcgtgaagggccagctggagagcatgtcg
ggcgagctgcggggaaagtactacccgctgaccggcatgacgaaggagacacagaagcag
ctgattgacgaccatttccttttcaaggagggcgaccgcttcctgcaggcggcgcacgcc
tgtgagttctggcccacgggacgtggcatctaccacaacgacgccaagacctttcttgtg
tgggtgaatgaggaggaccacctgcgcatcatctcgatgcagaagggcggcaacctgaag
gaggtgtttggccgccttgttactgccgttggcgtcatcgaggagaaggtgaaattctcg
cgtgacgaccgccttggcttcctgacgttctgcccgacgaaccttggcacgacgatccgt
gccagcgtgcacatcaagctcccgaagcttggcgcggaccgcaagaagttggaggaggtg
gcggcgaagtacaacctgcaggtgcgcgggacggctggcgagcactctgacagccccgac
ggtgtctatgacatcagcaacaagcgccgtctcggcctctccgagtatgaggcggtgaag
gagatgcaggacggcatcctggagctcatcaaggcggaggaatctgcgaggtga

DBGET integrated database retrieval system