KEGG   Trypanosoma cruzi: 508765.30
Entry
508765.30         CDS       T01012                                 

Definition
(RefSeq) glycosylphosphatidylinositol-specific phospholipase C
  KO
K06038  glycosylphosphatidylinositol diacylglycerol-lyase [EC:4.6.1.14]
Organism
tcr  Trypanosoma cruzi
Brite
KEGG Orthology (KO) [BR:tcr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    508765.30
Enzymes [BR:tcr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.14  glycosylphosphatidylinositol diacylglycerol-lyase
     508765.30
SSDB
Motif
Pfam: PI-PLC-X
Other DBs
NCBI-GeneID: 3534517
NCBI-ProteinID: XP_804924
GeneDB: Tc00.1047053508765.30
UniProt: Q4CS22
LinkDB
AA seq 380 aa
MLPESDDFTNNAWDPQSWMHDLRSFIGEMAITQVCLVGSHNAASYGTRKDSPFGADAPGF
LLGDSVFASLSRLLFRGICASWSRCQWMSVRAQLDYGVRYLDLRVATNPEDASRLYISHT
QISVPLADVLEDVKAFLNDPLSANEFIVLDFQHLYLTDDSDGKGKFFKELERLSDRFIPV
DVPLTTPLEMLWRVSRRRRIFLVVSSGEDELPYPAVRIRSKCMVSRWVDQGSLRKLLQAL
NNLLLDDLKYPQTGVPSKLHVTQAVYTPRKSNIFRGIFPKVSRKVVSSIYAVATRVNPSL
LEWFYLLNAHGLLDGAKVMIPSGINTHGNILMLDCVELGRCQIMDGTTETNAVGMCVYLN
FLRASRLCEDSSAAPFLKEG
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgctgccggagagtgacgacttcacaaataacgcgtgggatccacagagctggatgcat
gacctgcgctcgtttattggcgaaatggccataacacaggtgtgtcttgtgggttctcac
aacgcggcatcgtacggcactcgcaaggattcaccatttggtgcggacgcgccggggttt
cttcttggtgactcggtgtttgcttctctgtcacgcttactttttcgtgggatctgtgca
tcttggtcaaggtgtcaatggatgtctgtacgcgcgcagctggactacggtgtgcgctat
ctggacctgcgcgttgcgacaaacccagaggacgccagccgactgtacatatcacacacc
caaatctctgtgcctctggctgatgtgcttgaagatgtgaaggcgtttctcaatgacccc
ctttctgcgaatgaatttattgtgcttgattttcaacacctatatctcacggatgacagt
gacgggaagggtaagttcttcaaggagttggaacgcctttcagatcgctttatacccgtc
gatgtgccgctcacaacgccgttggaaatgttgtggagggtctcgcgcaggcgccgcatc
tttcttgtggtgagcagtggagaggatgagttgccataccccgcggtgcggattcgctct
aaatgtatggtatctcgatgggtagatcagggttcgttgaggaagctgctgcaggccctc
aataatttgctactggacgatctaaagtatccccagactggcgtgccttcaaaactgcac
gttacacaggctgtctatacgccacgaaagagtaacatttttcgtggtattttcccaaaa
gtatcaaggaaggttgtctcgagtatttatgccgtggcaacacgtgtgaacccgtccttg
cttgagtggttttatctgctgaatgcacatgggctcttggatggtgccaaggtgatgatt
ccatcagggataaacacacacggaaacatacttatgctggactgcgtggaactgggccgc
tgtcagataatggacggcacgacggagacaaatgccgttggcatgtgtgtataccttaac
ttcctacgcgcttcgcgtctatgtgaagattcctcggcagcgccgtttttgaaagagggt
tag

DBGET integrated database retrieval system