KEGG   Trypanosoma cruzi: 508851.189Help
Entry
508851.189        CDS       T01012                                 

Definition
(RefSeq) phosphoenolpyruvate mutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
tcr  Trypanosoma cruzi
Pathway
tcr00440  Phosphonate and phosphinate metabolism
tcr01100  Metabolic pathways
tcr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tcr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    508851.189
Enzymes [BR:tcr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     508851.189
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEP_mutase PA DUF2529
Motif
Other DBs
NCBI-GeneID: 3546022
NCBI-ProteinID: XP_814485
GeneDB: Tc00.1047053508851.189
UniProt: Q4DJB5
LinkDB All DBs
AA seq 299 aa AA seqDB search
MRHCCGLPQKARMLKSMLRSKELSFMMEAHNGLSARIVEETGFKAIWASGLSISAQMGFR
DNNEASWTQVCDVAEQMSDATSIPILLDADTGYGNFNNARLLVRKLEKNGVAGACVEDKL
FPKTNSLLDERGAQPLADVKEFALKIRAMKDTQTDENFCVVARVESFIAGWPLEEALKRA
TAYAEAGADAVLIHSKKKDSSEIDAFMGHWDNKTPVVIVPTSYASVPCAHFREIGISTVI
WANHNLRACIAAMQASTRMIFEQESVVAVGKNIASVKEVFRLQRLPEYLEAEEMYLPKK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcactgctgtggtctgccacagaaggcaaggatgttaaagtccatgctgcgctcc
aaggagctgagtttcatgatggaggcgcacaacggtctttccgcccgcattgtggaggag
acgggatttaaggcaatttgggcctcgggtctctcgatatccgcccaaatggggttccgc
gacaacaacgaagcgagttggacgcaggtgtgtgatgttgccgagcagatgagtgatgcg
acaagtattcccatcctgctggacgccgacacgggctacggaaacttcaacaacgctagg
ctgctcgtgcggaagctggagaagaatggtgtagccggtgcctgcgtagaggacaagctc
ttccccaagacgaatagtctgctggatgagaggggggcacagccgctcgcggatgtgaag
gagtttgcgctgaagattcgcgccatgaaggacacacaaaccgatgaaaacttttgcgtt
gtggcacgcgtcgagtccttcattgctggctggccactggaggaggcattgaagcgtgct
acggcgtatgccgaggcgggtgccgacgccgtactcattcatagcaagaagaaggactcc
tccgagattgacgccttcatgggccattgggataataagacgcccgttgtcattgtgccc
accagctacgccagcgtcccgtgcgcccacttccgcgagatcgggattagcaccgtcata
tgggcgaaccacaacctgcgggcctgcattgccgccatgcaggcctcgacgcggatgata
tttgagcaggagtcggttgtagcggtggggaagaacattgcgtcggtgaaggaggtcttc
cgactgcagcgacttcccgaatatcttgaggcggaggagatgtacttgccgaagaaataa

DBGET integrated database retrieval system