KEGG   Trypanosoma cruzi: 509461.30Help
Entry
509461.30         CDS       T01012                                 

Definition
(RefSeq) hypothetical protein
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
tcr  Trypanosoma cruzi
Pathway
tcr00310  Lysine degradation
tcr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    509461.30
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tcr03036]
    509461.30
Enzymes [BR:tcr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     509461.30
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     509461.30
Chromosome and associated proteins [BR:tcr03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     509461.30
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-Mss51 zf-MYND
Motif
Other DBs
NCBI-GeneID: 3542801
NCBI-ProteinID: XP_811771
GeneDB: Tc00.1047053509461.30
UniProt: Q4DBM3
LinkDB All DBs
AA seq 697 aa AA seqDB search
MPAAPQDRLVECVHSSDPNSDAGRYAVAKADISPGELVLIAAPYAVAMNPNEMPSAMSIA
TKVDEWVAATGSTNTASNSMTKRTRKNGSFPASIPNGYLPLLPHSTLCCNCLQLIPEGTL
FLNYETIRWVSGCIAAEHANYEMERWLNEDTEISQAKAVDVDADMEVSGEIDAGDDRQLK
KLQKTVKSGRMRSKLYVNLKKKLSEASARRHEKAMHEYHVKAMQMDNAQEVMWPERVVEG
EHSLPEGVTNQGVCGCAGCGVIVYCSRACWTEHHNLHRASGTCQTLRRVYPVLMKTFMVR
AGDNANSTDKKRFSPDSWSTKHWLRRTGEEAAWEMQTLLLNALLVAHCAREGFAGHMAEE
TEAMPATVNLSKSSEGEREVVCVVSSKNKTPLNLTNGRKLSGATTDAESQLSGAAALIAT
DCAVPQKVEILRMARLQCGGVVEVLDPKALEGGNEFRDPETASQLYFSLRSNMSLGVFEE
KEETHAVRPPRWSDTARLVTNLSMLSKDSRSKFRCAYRRFTKLILPWLGEGGSTEANLTV
TATFFNRLCAALQCNSFGLFNADGNCIGVALYPEASYFNHSCCPNICRVTYRGILAAFHA
LREIRKGEPLTICYVDVQETSTAERRRTLFSSYRFFCECARCSGANTAAMEIRLCDSCAI
RGYILPVPPSSAFRWGMDAVQEGICSVCRKCVPWNQK
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgccggcggcaccgcaagaccggttggtggagtgtgtacattcttccgacccaaattct
gacgcagggcgctacgcggtagccaaggccgacatcagccccggtgaacttgtcctcatt
gctgccccgtatgccgtggcgatgaacccgaatgaaatgcccagtgcaatgtccatagca
accaaggtggacgagtgggtggctgccaccgggagcacgaatacggcgagcaactcgatg
acaaagaggacaaggaaaaatggttcttttccagcctcaatcccaaatggatacttgcct
ctattgccccattcaacactctgttgtaactgtctgcaacttattccggaaggtacccta
ttcctaaattatgagactattcgatgggtttccggctgtattgctgcagaacacgccaac
tatgagatggagaggtggttgaatgaagatacagaaatttcacaagcaaaagccgttgac
gtggatgctgatatggaggtttccggggaaattgatgcgggagatgataggcaacttaaa
aagttgcaaaaaactgttaagtctggtcggatgcgctccaaattgtacgtgaatctgaag
aagaagctgtcagaagcctccgcacggcggcatgaaaaagcaatgcacgaatatcatgtg
aaggcaatgcagatggataatgcacaggaagtcatgtggccagaacgtgtggtggaaggg
gaacatagtcttccggagggtgtaacaaaccaaggcgtgtgtggatgcgccgggtgtggt
gttattgtgtactgctcgagggcatgttggacggagcatcacaatttgcacagagcttca
ggtacgtgtcaaacgctgcgccgcgtgtatccagtactcatgaagacgtttatggtacgt
gctggtgataatgcaaactcaacagacaagaaacgattttcccctgattcatggagtaca
aagcattggcttaggcgaacaggcgaggaggcagcatgggagatgcagacattactcttg
aatgcattgctggtggcacactgtgcaagggaagggtttgctggtcatatggcagaggaa
acggaagccatgcccgccacggttaatctcagcaaaagtagcgagggggaacgagaagtc
gtttgtgttgtctcttcaaagaataaaacacccttaaatttaacgaatgggagaaaactc
agcggtgctaccactgacgcggaatctcagttatcaggggcagctgcgttgatcgctacg
gactgtgcggtacctcagaaggtggaaatacttcgtatggctcgcctgcagtgcggtggt
gtggtggaagttctggatcccaaagctcttgagggtggcaacgaattccgtgacccagaa
acggcgtcgcagctttacttctccctgaggagcaacatgtcattaggtgtatttgaggag
aaagaggaaacacatgccgttcgaccaccaagatggagtgatacggcccgattagttaca
aatctttcaatgctgagcaaagactcgcgcagtaagtttcgttgtgcctatcgccgcttt
acaaaattgattcttccctggctgggtgaaggtgggagtaccgaggccaatttgactgtt
acagccaccttctttaatcgcctgtgtgctgcattgcagtgcaacagctttggtttgttt
aacgcggacggtaactgcattggcgtcgcactctatccggaagcatcgtatttcaatcac
agttgttgcccaaatatctgtcgagtcacatatcgtggaattcttgcagcatttcatgct
cttcgagagatacggaagggtgagcccctcaccatttgctacgtggatgttcaagagact
tcgaccgcagagcgccgtcgcacgcttttttcctcttaccgttttttctgcgaatgtgct
cgttgcagtggggcgaacacagcggcaatggagattcgtctgtgtgattcatgcgccata
cgtggttacattttacccgttccgccttcctcggcctttcgctgggggatggatgctgtg
caagagggaatctgttccgtttgccgaaaatgtgtgccgtggaatcagaaataa

DBGET integrated database retrieval system