KEGG   Trypanosoma cruzi: 511735.60Help
Entry
511735.60         CDS       T01012                                 

Definition
(RefSeq) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
tcr  Trypanosoma cruzi
Pathway
tcr04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:tcr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    511735.60
Enzymes [BR:tcr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     511735.60
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 3535737
NCBI-ProteinID: XP_805860
GeneDB: Tc00.1047053511735.60
UniProt: Q4CUQ5
LinkDB All DBs
AA seq 344 aa AA seqDB search
MVVEGKKLGGREAKGPFLSSHAWGWITHGMFLLLLLPMPLCFCSLWTHLHACCCCPSGPL
RLSPGQVERHAKGIVQQMRRTLRHGYHAYVPKGALLKTDMLASSPQLVTAVFRETEAAAE
RADRANDDAGFFSRPRLNYPVASGIPAFISRRQFDVQYNIFHHDAVETLNRHTLGTSLEG
HSLETVIRRTSFDATQAAAHTAAAEHFNYCFFYKSLRPWGTAVPKQLREAFQLQYGRDGS
VDVVEEVKRLLTVVVLSHQERCGWVYLVWTGKQFDVVEFPHGACPIGSDLIPLLAINVHE
GAYSLDYGLSGLEQYAQNYFRACNWFLAERYYLQATGRGSSCDA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggtggtggaggggaagaaattgggtggtagagaggcgaaggggcccttcttgtcctcg
catgcgtggggatggataactcatgggatgtttttgctgctgttgctgcctatgcctctt
tgtttttgttctctctggacgcatttgcatgcatgctgttgctgcccatccgggcctctc
cgtctttctcctgggcaagtagaaaggcacgcgaagggaattgtgcagcaaatgcgccgg
acgttacgtcatggctaccatgcctacgttccaaagggcgcgcttctcaaaacagacatg
ctcgcatcttcgccccaattggtgacggccgtgttccgtgagacggaggccgcggcagaa
cgtgcggacagggcgaatgatgatgcaggcttttttagccgacctcgactgaactatcca
gtcgcgtccggcattccggcatttatctccaggcgacagttcgatgtgcagtacaatatc
tttcaccacgatgcggtggagacgctcaaccggcacacattaggcacctcactggagggg
cacagtcttgagaccgtcatacgtagaacgtcgtttgatgccacgcaggcagcagcgcac
accgcggcggccgagcacttcaactattgtttcttttacaagtcgcttcggccatgggga
acggcggtaccaaaacaacttcgcgaggcttttcagttgcaatacggccgcgacggatcg
gtagatgtggtggaggaggtgaagcggctgttaacggtcgtggttctctcgcaccaagag
cgttgtggttgggtttaccttgtctggacaggaaagcagtttgatgtcgtggagtttcct
cacggtgcgtgccccattggcagtgatctcatcccactcctggcgattaacgtgcatgaa
ggcgcctattccctcgactacggtctttcgggactggagcaatacgcacaaaactacttt
agggcgtgcaattggttcctcgctgaacgatattacttgcaggcgacggggagggggtcg
agttgcgatgcatga

DBGET integrated database retrieval system