KEGG   Trypanosoma cruzi: 511909.40Help
Entry
511909.40         CDS       T01012                                 

Definition
(RefSeq) succinate dehydrogenase flavoprotein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
tcr  Trypanosoma cruzi
Pathway
tcr00020  Citrate cycle (TCA cycle)
tcr00190  Oxidative phosphorylation
tcr01100  Metabolic pathways
tcr01110  Biosynthesis of secondary metabolites
tcr01130  Biosynthesis of antibiotics
tcr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tcr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    511909.40
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    511909.40
Enzymes [BR:tcr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     511909.40
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 3540028
NCBI-ProteinID: XP_809424
GeneDB: Tc00.1047053511909.40
UniProt: Q4D4X1
LinkDB All DBs
AA seq 609 aa AA seqDB search
MLRRIFARFSPKLSKAYPMIDHTFDCVVVGAGGSGLRAAMGVAASGYDVACISKLYPSRS
HTIAAQGGINAALANCEEDDWRWHVYDTVKGSDWLGDQDAIQYMCQEAPCVVSELESMGL
PFLRTKDGFIYQRAFGGQSIHFGGKQARRTCAASDRTGHAMLHTLYGQSFQYGVNFFNEY
YCLDLIVEDGCCRGVVAMSIDDGTIHRFRSKYTILATGGYGRCWFTTTSAKSCTGDGTAM
VARAGLPAEDMEFVQFHPTGIYGPGVLITEGARGEGGYLVNSEGERFMERYAPKAKDLAS
RDVVSRAITLEVLAGRGCGPKKDHVLLQLHHLPPEQLHEKLPGISESAHIFAGVDVTKES
IPIVPTVHYNMGGIPTLWTGEVVSPRNGDDDAIVPGLLAAGECACASVHGANRLGANSLL
DIVVFGKSCANTVIFNLTKEGRNQPELRPDAGESSIADLDGILHNKGDIPVARIRERMKE
TMALYAAVFRTEESMLKGQGIIEECYRDYSHVFVHDKSPVWNSNLIEALELRNLLTNALL
TITGAAVRRESRGAHARDDYPERDDHNWMKHTLAYLDDKNGKARLAYRRVHNEMLTNELE
SIPPAKRVY
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgccgcatatttgcccgcttctccccgaagctgagtaaggcgtacccgatgatt
gaccacacctttgactgtgtggtggttggtgccggtggttcagggcttcgtgctgcgatg
ggcgttgccgcgtccggctacgacgtggcatgcatctccaaactctatccatcaaggtca
cacaccattgctgcccagggcggcatcaacgcagcacttgccaactgtgaggaggacgac
tggcgttggcatgtgtacgataccgtgaagggaagtgactggctgggggaccaggatgca
attcagtacatgtgccaagaagctccgtgtgtggtctcagaactagagagcatgggactt
cccttcttgcgtacaaaagatggatttatttatcaacgtgcatttggcggccaatctatt
cactttggtggaaaacaggcgcgccggacgtgtgccgcgtcggaccgcacgggacacgca
atgctccacacactctatgggcaatcgtttcagtacggcgtgaacttttttaacgaatat
tattgcttagacctgattgtagaagatggatgctgccgtggagtggttgccatgagcatc
gatgatggcacaattcatcgcttccgatccaagtacactattcttgccaccggtggttac
ggccgctgctggtttacaacaacaagcgccaagtcttgtaccggagacgggacggcaatg
gtggcacgtgcagggctgccggcggaagacatggaatttgtgcagttccacccaacggga
atttacggtcctggtgtgctgattaccgagggggcccgtggcgagggtggttacctcgtc
aacagtgaaggggagcgcttcatggagcgatacgcccccaaggcaaaggatttggcgtct
cgtgatgtggtgtcacgcgccattacgttggaggttcttgcaggacgtggctgtggcccc
aagaaggatcacgtcctgctgcaacttcatcatctcccacccgagcaactacatgagaag
cttcccggtatctccgagagcgcacatatttttgcgggtgtggacgtgacgaaggagtcc
atccctatcgtgccgacggtgcactacaacatgggaggcatcccaacattgtggacgggc
gaggtagtcagtccccggaatggcgatgacgatgcgatcgtcccaggtcttttggcggcg
ggcgagtgtgcgtgcgcgagtgtgcatggggcaaatcgtctgggtgccaactccctcctc
gacattgttgtttttggcaaatcatgtgcgaacaccgtcatatttaacctgacgaaggaa
ggacgcaatcagccggagctgcggcccgatgccggggagtcgtccattgccgatcttgac
ggcattctgcacaacaagggggacatccctgtcgcacgcatccgtgagcgcatgaaggag
acgatggcgctctacgcagccgtgtttcgcactgaggagagcatgctcaagggacagggg
atcattgaagaatgttaccgggattactcccatgtgtttgtccacgacaagtccccggtg
tggaacagcaaccttattgaggcgctcgagctgcgtaatttgctcacaaacgcgcttttg
accatcactggagctgccgtgcggcgggagtctcgtggggcacatgcacgcgacgactac
ccggagcgagacgaccacaactggatgaagcatacacttgcgtacctcgatgacaaaaac
ggtaaagcccgtcttgcgtaccgccgagtacacaacgaaatgctaacaaatgaacttgaa
agcatccctcctgccaagcgtgtttactag

DBGET integrated database retrieval system