KEGG   Thermomonospora curvata: Tcur_1207Help
Entry
Tcur_1207         CDS       T01127                                 

Definition
(GenBank) DNA polymerase LigD, polymerase domain protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
tcu  Thermomonospora curvata
Pathway
tcu03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:tcu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Tcur_1207
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tcu03400]
    Tcur_1207
Enzymes [BR:tcu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Tcur_1207
DNA repair and recombination proteins [BR:tcu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Tcur_1207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prim-Pol
Motif
Other DBs
NCBI-ProteinID: ACY96790
UniProt: D1A994
LinkDB All DBs
Position
complement(1363960..1364868)
Genome map
AA seq 302 aa AA seqDB search
MSGGERVRVRVEDRELRLSNLDKVLYPRHGFTKGELIDYYTRIAPVLLPHLRDRPVTRKR
YPDGMAGQSFFEKNAPPGTPPWVRTVNLPTPGSAKGRASADYVMVDDLPTLVWLANLAAV
ELHVPQWRVGPRGGVHRPDLMVFDLDPGPHTTIVDACRVACALRALLADDGLRAYPKTSG
KKGLHLYVPVRETGRTRQYAEQAAKRLEADAPRHVTARMDRRLRKGKIFIDWSQNDPGKT
TVAPYSMRASGGPAVSTPLAWEEVENCEDPADLVFFSDQALERVQRHGDLMAPLLEEGPP
LP
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggcggcgagcgggtccgcgtccgggtggaggaccgggagctcaggttgtcgaac
ctggacaaggtgctctacccccggcacgggttcaccaagggcgagctgatcgactactac
acccggatcgcgcccgtcctgctgccgcacctgcgggaccggccggtgacccgcaagcgc
taccccgacgggatggccgggcagtccttcttcgaaaagaacgcgcccccgggcaccccg
ccgtgggtgcgcacggtgaacctgccgaccccgggcagcgccaaagggcgggcctcggcc
gactacgtgatggtcgacgacctgcccaccctggtgtggctggccaatctggccgcggtg
gaactgcacgtcccgcaatggcgggtcggcccgcgcggcggggtgcaccgccccgacctg
atggtcttcgacctggaccccggcccgcacaccaccatcgtggacgcctgccgggtggcc
tgcgcgctgcgcgccctgctggccgacgacggcctgcgcgcctaccccaagaccagcggc
aaaaagggcctgcacctgtatgtgccggtgcgggagaccggccggacccggcagtacgcc
gagcaggcggccaagcggctggaggccgacgccccccgccacgtcaccgcccggatggac
cggcggctgcgcaaaggcaagatcttcatcgactggagccagaacgacccgggcaagacc
accgtcgccccttattccatgcgcgcctccggcggcccggcggtgtccacccccctcgcc
tgggaagaggtcgaaaactgcgaagaccccgccgacctggtgttcttctccgaccaggcg
ctggagcgcgtacaacggcacggcgacctgatggcgccgctgctggaggagggaccaccc
ctgccctga

DBGET integrated database retrieval system