KEGG   Thermomonospora curvata: Tcur_1827Help
Entry
Tcur_1827         CDS       T01127                                 

Definition
(GenBank) Betaine-aldehyde dehydrogenase
  KO
K00130  betaine-aldehyde dehydrogenase [EC:1.2.1.8]
Organism
tcu  Thermomonospora curvata
Pathway
tcu00260  Glycine, serine and threonine metabolism
tcu01100  Metabolic pathways
Module
tcu_M00555  Betaine biosynthesis, choline => betaine
Brite
KEGG Orthology (KO) [BR:tcu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tcur_1827
Enzymes [BR:tcu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.8  betaine-aldehyde dehydrogenase
     Tcur_1827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Dpy-30
Motif
Other DBs
NCBI-ProteinID: ACY97400
UniProt: D1ACR1
LinkDB All DBs
Position
complement(2140058..2141491)
Genome map
AA seq 477 aa AA seqDB search
MHEHDRLFIGGQWTAPAGTGVIEVISPHTEEVIGRVPEGTQADIDRAVAAARRAFDEGPW
PKMTPAERAEIVGRLAAIYAERQQQMAELVTAQMGSPILFSVFGQAAIPQQVLQYYVDLA
ATYPWEEERQGMLGPVTVTREPVGVVAAIVPWNVPQFTLMLKLAPALIAGCTVVAKPSPE
TPLDSYLLAEWITEAGIPEGVVSFVPAGREVGAYLVAHPDVDKVSFTGSTAAGRQIGEVC
GRQLKRVTLELGGKSAAILLEDADLAATMEGLKLASLMNNGEACAAQTRILAPRSRYDEV
ADALAEMVGSLKVGDPADYSTEIGPLVSRRQQERVEGYIRLGQEEGAKVITGGLNRPYDR
GWYVAPTVFADVDNSMRIAQEEIFGPVLALIPYEDEADAIRIANDSSYGLGGSVWTADVA
HGIEVARQIRTGSCGVNMYTLDPNTPFGGFKNSGLGRELGPEGLVAYLEHKSIPHPA
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcacgagcacgaccggctgttcatcggcggccagtggacggctccggccggcaccggc
gtcatcgaggtgatctccccgcacaccgaggaggtcatcggccgggtgcccgagggcacg
caggccgacatcgaccgcgcggtcgccgccgcccgccgggccttcgacgaaggcccctgg
cccaagatgaccccggccgagcgggccgagatcgtgggacggctggcggcgatctacgcc
gaacgccagcagcagatggccgagctggtcaccgcccagatgggctcgccgatcctgttc
tcggtcttcgggcaggccgcgatcccccagcaggtgctgcagtactacgtggacctggcc
gccacctacccctgggaggaagagcggcagggcatgctcgggccggtgaccgtcacccgg
gagccggtcggagtggtggcggcgatcgtgccgtggaacgtcccgcagttcaccctgatg
ctcaagctggccccggcgctgatcgccgggtgcacggtggtggccaagccgtccccggag
accccgctggactcctacctgctggccgagtggatcaccgaggcgggcatccccgagggc
gtggtcagcttcgtgcccgccgggcgcgaggtcggcgcctacctggtggcgcacccggat
gtggacaaggtctccttcaccggctccacggcggccgggcggcagatcggggaggtctgc
ggccgccagctcaagcgcgtcaccctggagctgggcggcaagtccgcggcgatcctgctg
gaggacgccgacctggccgccaccatggagggcctgaagctggcctcgctgatgaacaac
ggggaggcctgcgccgcgcagacccgcatcctggccccgcgcagccgctatgacgaggtg
gccgacgcgctggcggagatggtcggctcactgaaggtcggcgacccggccgactactcc
accgagatcggcccgctggtcagccgccgccagcaggagcgggtggagggctacatccgg
ctgggccaggaggagggcgccaaggtgatcaccggcgggctcaaccgcccctacgaccgg
ggctggtacgtggcgcccaccgtgttcgccgacgtggacaactcgatgcgcatcgcccag
gaggagatcttcggccccgtgctggccctcatcccctatgaggacgaggccgacgccatc
cgcatcgccaacgacagctcctacgggctgggcggctcggtgtggacggccgatgtggcg
cacggcatcgaggtcgcccggcagatccgcaccggaagctgcggcgtcaacatgtacacc
ctcgaccccaacacccccttcggcggcttcaagaacagcggcctgggccgcgagctgggg
ccggagggactggtcgcctacctggagcacaagtccatcccccacccggcctga

DBGET integrated database retrieval system