KEGG   Thermomonospora curvata: Tcur_2773Help
Entry
Tcur_2773         CDS       T01127                                 

Definition
(GenBank) Beta-ketoacyl synthase
  KO
K05551  minimal PKS ketosynthase (KS/KS alpha) [EC:2.3.1.- 2.3.1.260 2.3.1.235]
Organism
tcu  Thermomonospora curvata
Pathway
tcu00253  Tetracycline biosynthesis
tcu01056  Biosynthesis of type II polyketide backbone
tcu01100  Metabolic pathways
tcu01110  Biosynthesis of secondary metabolites
Module
tcu_M00778  Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide
Brite
KEGG Orthology (KO) [BR:tcu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    Tcur_2773
   00253 Tetracycline biosynthesis
    Tcur_2773
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:tcu01004]
    Tcur_2773
   01008 Polyketide biosynthesis proteins [BR:tcu01008]
    Tcur_2773
Enzymes [BR:tcu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.235  tetracenomycin F2 synthase
     Tcur_2773
    2.3.1.260  tetracycline polyketide synthase
     Tcur_2773
    2.3.1.-  
     Tcur_2773
Lipid biosynthesis proteins [BR:tcu01004]
 Polyketide synthase
  Component type
   Tcur_2773
Polyketide biosynthesis proteins [BR:tcu01008]
 Polyketide synthase (PKS)
  Type II PKS
   C7-C12 cyclized polyketide type
    Octaketide PKS
     Tcur_2773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N
Motif
Other DBs
NCBI-ProteinID: ACY98319
UniProt: D1A6R5
LinkDB All DBs
Position
complement(3230131..3231399)
Genome map
AA seq 422 aa AA seqDB search
MSRRAVITGMGVLAPGAVGVKEYWSLLSEGRTAIRTITHFDPSPFRSRMAGECDFDPVKE
GLTRQQIRRLDRAAQFAIVAGREAIADSGLDFDRLDPTRVAVALGCAIGCTTSLEREFVI
GSADGSQWEIDQNYSVPHLYDYVNPSSMAAELAWLVGAEGPTTMVSTGCTSGIDSVGYAA
RLIEEGSADVVISGGTEAPLSPITVVCFDVLRASSTRNDDPATACRPFDRTRDGLVLAEG
SAILIVEELEHARARGARIWGEVAGYASRCNAYHMTGLEPEGREMAEAIEAAMDKARVLP
AHIDYINAHGSGTKQNDLHETGAFKRSLGEEAYRIPISAFKSMIGHSLGAIGSLEIAGCL
LAIQQDLIPPTANLHEPDPLCDLDYVPLVAREKRVHTALTVGSGFGGFQSAMVLRQMGGD
KR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtcgcgctgtgatcacggggatgggtgtactggcgccaggcgccgtcggggtg
aaggagtactggagtctgctgtcggaggggagaacggccatccggacgatcacccacttc
gacccctcgcccttccggtcccgcatggccggcgagtgcgacttcgaccccgtcaaggaa
gggctgacccggcagcagatccgccgtctggaccgcgcggcgcagttcgcgatcgtcgcc
ggcagggaggcgatcgccgactcgggcctggacttcgaccggctggaccccacccgggtc
gccgtggccctcggatgcgcgatcggctgcacgaccagcctggagcgggagttcgtgatc
ggcagtgccgacggcagccagtgggagatcgatcagaactactccgtcccgcacctgtac
gactatgtgaaccccagctcgatggccgccgagctggcctggctggtgggtgcggagggc
cccaccaccatggtctccaccggctgcacctccggcatcgactccgtcggctatgcggcc
cgcctcatcgaggagggcagcgccgatgtcgtgatcagcgggggcaccgaggcgccgttg
tccccgatcaccgtggtctgcttcgatgtgctgcgggccagctcgacccgcaacgacgac
ccggccaccgcctgccgcccgttcgaccggacgcgggacggcctggtgctcgccgaaggc
agcgccatcttgatcgtggaggagctggagcacgccagggcccgcggtgcccggatctgg
ggcgaggtcgccggttacgcctcccgctgcaacgcctaccacatgaccggcctcgaaccc
gagggcagggaaatggcggaggccatcgaggccgcgatggacaaggcgcgggtgctgccg
gcccacatcgactacatcaacgcgcacggctcgggcaccaagcagaacgacctgcacgag
accggcgccttcaaacgcagcctcggcgaggaggcctaccggataccgatcagcgccttc
aaatcgatgatcgggcattcgctcggggcgatcggctccttggagatcgccgggtgcctg
ctggcgatccagcaggacctcatccctccgacggcgaatctgcacgaacccgatcctctg
tgcgacctggactacgtgcccttggtggcgcgcgagaagcgggtccacaccgcgctgacg
gtcggcagcggcttcggcggtttccagagcgcgatggtcctgcggcagatgggcggagac
aagcgatga

DBGET integrated database retrieval system