KEGG   Thermomonospora curvata: Tcur_3231
Entry
Tcur_3231         CDS       T01127                                 

Definition
(GenBank) undecaprenyl diphosphate synthase
  KO
K21273  trans,polycis-polyprenyl diphosphate synthase [EC:2.5.1.88]
Organism
tcu  Thermomonospora curvata
Pathway
tcu00900  Terpenoid backbone biosynthesis
tcu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tcu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Tcur_3231
Enzymes [BR:tcu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.88  trans,polycis-polyprenyl diphosphate synthase [(2Z,6E)-farnesyl diphosphate specific]
     Tcur_3231
SSDB
Motif
Pfam: Prenyltransf
Other DBs
NCBI-ProteinID: ACY98770
UniProt: D1A9T4
LinkDB
Position
complement(3732885..3733679)
AA seq 264 aa
MNRAVQPPYPHPSGARPPAIPKELVPRHVAIVMDGNGRWAKQRGLPRTEGHKMGEHSLFD
VIMGAIELGIPYLSAYAFSTENWKRSPEEVRFLMGFNRDVIRRRRDQLHSMGVRVRWAGR
RPRLWRSVIKELEEAERLTADNDVLTLQFCVNYGGRAEITDAAAAIARDVAAGKLNPDKI
NEKVFARYLYRPEVPEVDLFLRPSGEQRLSNFLLWQSAYAEFVFQDVLWPDFDRRHLWQA
CEIYATRDRRYGGAEPNPVPVKTS
NT seq 795 nt   +upstreamnt  +downstreamnt
ttgaacagggccgtccagccgccatatccccaccccagcggggcccggccgccggccatc
cccaaagagctcgtgccccggcacgtggccatcgtgatggacggcaacggacgctgggcc
aagcagcgcgggctgccgcgcaccgaggggcacaagatgggggagcactccctcttcgac
gtgatcatgggcgcgatcgagctgggcatcccctacctgtcggcctatgcgttctccacc
gagaactggaagcgctccccggaggaggtgcgcttcctgatgggcttcaaccgggatgtg
atccgccgccgccgcgaccagctgcattcgatgggggtgcgggtgcgctgggcgggccgc
aggccccggctgtggcgcagtgtgatcaaggagctggaggaggccgagcggctgaccgcc
gacaacgacgtgctgacgctgcagttctgcgtcaactacggcgggcgggccgagatcacc
gacgccgccgccgccatcgcccgcgacgtggccgccggcaagctcaaccccgacaagatc
aacgagaaggtgttcgcccgctacctgtaccgtcccgaggtgccggaggtggacctgttc
ctgcggccctcgggggagcagcgcctgtccaacttcctgctgtggcagtcggcctatgcg
gagttcgtcttccaggacgtgctgtggcccgacttcgaccgccggcacctgtggcaggcc
tgcgagatctacgccacccgcgaccgccgctacggcggcgccgagcccaacccggtaccg
gtgaagacctcctga

DBGET integrated database retrieval system