KEGG   Thermomonospora curvata: Tcur_3380Help
Entry
Tcur_3380         CDS       T01127                                 

Definition
(GenBank) aminotransferase class-III
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
tcu  Thermomonospora curvata
Pathway
tcu00250  Alanine, aspartate and glutamate metabolism
tcu00410  beta-Alanine metabolism
tcu00640  Propanoate metabolism
tcu00650  Butanoate metabolism
tcu01100  Metabolic pathways
tcu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Tcur_3380
   00650 Butanoate metabolism
    Tcur_3380
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Tcur_3380
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Tcur_3380
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tcu01007]
    Tcur_3380
Enzymes [BR:tcu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Tcur_3380
Amino acid related enzymes [BR:tcu01007]
 Aminotransferase (transaminase)
  Class III
   Tcur_3380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ACY98918
UniProt: D1AAX5
LinkDB All DBs
Position
complement(3898590..3899885)
Genome map
AA seq 431 aa AA seqDB search
MSDLLARHRAVMPNWMALYYERPIEIVSGKGVRVTDAEGNTYLDFFAGIITNILGYDVEE
VRQAVERQLATGVVHTSTAYLLRGQVELAEKIVALSGIKDAKVFFVNSGTEANETALLLA
TYARKSNQVLAMRQSYHGRSFGAIGVTANRSWKNNAYTPLTVHFLHGGDRHLPQFAHLSD
ADFIKVCTEDLRHVLATATGGDVAALIAEPIQGVGGFTMPPDGLYAAYKEVLDEYGALFI
SDEVQTGWGRTGQSFFGIHNHGVTPDIMTFAKGLGNGFAVGGVVARGDLMDAPHATGLST
FGGNPIAMAAANATLDYILDHDLQSNAARQGALLLDGLKEAAPRLPVVGAVRGKGLMFAV
ELVEPGTGEPSPPLAAAVMEETRKRGLLVGKGGLYGNVIRMAPPLTITEEDAREGLGILI
DSLEAVSEAAK
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacctgcttgcgcgccaccgcgccgtcatgccgaactggatggcgctctactac
gagcggcccatcgagatcgtcagcggtaagggcgtccgcgtcacggacgccgagggcaac
acctacctggacttcttcgccggcatcatcaccaacatcctcggctacgacgtcgaggag
gtgcgccaggccgtcgagcggcagctggccaccggggtggtgcacacctccaccgcctac
ctgctgcgcggccaggtggagctggccgagaagatcgtcgccctgtcggggatcaaggac
gccaaggtcttcttcgtcaactccggcaccgaggccaacgagacggcgctgctgctggcc
acctacgcccgcaagagcaaccaggtgctggccatgcggcagagctaccacggccgctcc
ttcggcgccatcggggtgaccgccaaccggagctggaagaacaacgcctacaccccgctg
accgtgcacttcctgcacggcggcgaccggcacctgccgcagttcgcccacctgtcggac
gccgacttcatcaaggtctgcaccgaggacctgcggcacgtgctggccaccgccaccggc
ggggacgtggcggcgctgatcgccgagccgatccagggggtgggcggcttcaccatgccg
ccggacggcctgtacgccgcctacaaggaggtcctggacgaatacggcgcgctgttcatc
tccgacgaggtgcagaccggctggggccgcaccgggcagagcttcttcggcatccacaac
cacggcgtgacgcccgacatcatgaccttcgccaaggggctgggcaacggtttcgcggtc
ggcggcgtggtggcccgcggcgacctgatggacgccccgcacgccaccgggctgtccacc
ttcggcggcaacccgatcgccatggccgccgccaacgccaccctcgactacatcctcgac
cacgacctgcagagcaacgccgcccgtcagggggcgctgctgctggacggcctgaaggag
gccgcgccgcggctgccggtggtgggcgcggtgcgcggcaaggggctgatgttcgccgtc
gagctggtcgagccgggcaccggcgagcccagcccgccgctggccgccgcggtgatggag
gagacccgcaagcgcggcctgctggtcggcaagggcgggctgtacggcaacgtcatccgg
atggcgccgccgctgacgatcaccgaggaggacgcccgggaagggctgggcatcctgatc
gactccctggaggcagtgagcgaggccgccaagtga

DBGET integrated database retrieval system