KEGG   Thermomonospora curvata: Tcur_3687Help
Entry
Tcur_3687         CDS       T01127                                 

Definition
(GenBank) superoxide dismutase, Ni
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
tcu  Thermomonospora curvata
Brite
KEGG Orthology (KO) [BR:tcu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Tcur_3687
Enzymes [BR:tcu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Tcur_3687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni DUF2937
Motif
Other DBs
NCBI-ProteinID: ACY99220
UniProt: D1ACG1
LinkDB All DBs
Position
4239947..4240354
Genome map
AA seq 135 aa AA seqDB search
MQVLAKLLRPKTTVFAHCDLPCGVYDPAQARIEAESVKAIIEKYHANEDPVFRTRALIIK
EQRSNLVKEHLWVLWTDYFKPHHFEKYPQLHQLFNEATKLAGAAGTKQSVDVKVAEELLA
KIAEIDKIFWETKQS
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgctggcaaagctactgcgtccgaagaccacggtctttgcgcactgcgacctg
ccgtgcggcgtctacgacccggcgcaggcgcgcatcgaggccgagtcggtcaaggccatc
atcgagaagtaccacgccaacgaggacccggtcttccgcacccgggcgctgatcatcaag
gagcagcgctccaacctggtcaaggagcacctgtgggtgctgtggaccgactacttcaag
ccgcaccactttgagaagtacccgcagctccaccagctgttcaacgaggcgaccaagctc
gccggggcggccggcaccaagcagagcgtggatgtgaaggtggccgaggagctgctggcc
aagatcgccgagatcgacaagatcttctgggagaccaagcagtcctga

DBGET integrated database retrieval system