KEGG   Thermomonospora curvata: Tcur_4129Help
Entry
Tcur_4129         CDS       T01127                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
tcu  Thermomonospora curvata
Pathway
tcu00620  Pyruvate metabolism
tcu00680  Methane metabolism
tcu00710  Carbon fixation in photosynthetic organisms
tcu01100  Metabolic pathways
tcu01120  Microbial metabolism in diverse environments
tcu01200  Carbon metabolism
Module
tcu_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:tcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tcur_4129
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Tcur_4129
   00680 Methane metabolism
    Tcur_4129
Enzymes [BR:tcu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Tcur_4129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ACY99657
UniProt: D1A204
LinkDB All DBs
Position
complement(4711315..4713993)
Genome map
AA seq 892 aa AA seqDB search
MRDSAAGQVPSEQRKALREEMPEPLRRDVRLLGAMLGEILVEYGGPDLLEDVERLRHAVI
DARQGRVSIDEAAALVAGWDLERAELVARAFTVYFHLTNLAEEHHRIRALRERDTDPAHP
VSGSLAAAVAQIRGTGEHRLAQVLDGLEFRPVFTAHPTEARRRAVVTAIMRISALLQDFN
DPRKGAAERDEIRRQLREEIDLLWRTALRRHTQMDPLDEVRTAMAAFDETIFRVVPQLYR
ALDSALDVGASGPASGARPPRAHAYLRFGSWIGGDRDGNPYVTAQITREAVLIQSDHVLR
ALENACTRIGRRLTVSSATTPPSAALRNALDAARTAYPLLIAELAKRSPEEPHRQYLLYV
AERIAATRARHADMAYRSPEELLADLRLVQESLAGAGAVRQAYGELQHLIWQTETFGFHL
AELEIRQHSQVHEKALAEVRAGGALSEMTEEVLDTLRVVSWIQRRFGVRACHRYVVSFTR
SADDIAAVYELAESLGDHAPVLDVVPLFETGEDLDRAPSVLEGMLKLPAVQRRLAETGRR
LEVMLGYSDSAKQLGPTSATLRLYDAQAALAAWAARNGITLTLFHGRGGSLGRGGGPANR
AILAQAPGSVNGRFKVTEQGEVIFARYGQREIAKRHIEQVTNAIMLASTPAVEARAHEAA
VRFRPLADRISAAAQAAFRALIETEGFAEWFARVSPLEEISRLRIGSRPARRTATRSLED
LRAIPWVFAWTQTRVNLPGWYGLGSGLEAVLGGGDDEAGLAELQEAYRSWPLFAVMLDNA
EMSLAKADRAIAERYLALGGRPELTERVLAEYDRTRSLVLAVTGHRRLLENRRVLSRAVE
LRNPYVDALSLLQLRALTALREGVADDAERARLEELLLLSVNGVAAGLQNTG
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgactcggccgccggccaggtcccctcggagcaacgcaaagcgctgcgcgaggaa
atgcccgagccgctgcggcgggacgtccggctgctgggcgccatgctgggcgagatcctc
gtcgagtacggcggcccggatctgctggaggacgtggagcggctgcggcacgccgtcatc
gacgcccgccagggccgcgtctccatcgacgaggccgccgcgctggtggccggctgggac
ctggagcgcgccgagctggtcgcgcgggccttcaccgtctacttccacctgaccaacctg
gccgaggagcaccaccgcatccgcgccctgcgcgagcgggacaccgacccggcccacccg
gtctccggctcgctggcggcggcggtggcgcagatccgcggcaccggcgagcaccgcctg
gcgcaggtgctggacgggctggagttccggccggtcttcaccgcccaccccaccgaggcc
cgccgccgcgccgtggtcaccgcgatcatgcggatcagcgcgctgctgcaggacttcaac
gacccccgcaagggcgccgccgagcgggacgagatccgccggcagctgcgcgaggagatc
gacctgctgtggcgcaccgcgctgcgccgccacacccagatggacccgctggatgaggtc
cgcaccgcgatggcggccttcgacgagaccatcttccgggtcgtcccgcagctgtaccgc
gccctcgacagcgccctggacgtgggggcgagcggcccggccagcggcgcccgcccgccc
cgcgcccacgcctacctgcgcttcggcagctggatcggcggcgaccgggacggcaacccg
tatgtgaccgcgcagatcacccgcgaggcggtgctgatccagtccgaccacgtgctgcgc
gccctggagaacgcctgcacccgcatcggccgccggctgaccgtcagctccgccaccacc
ccgccgtcggccgcgctgcgcaacgcgctggacgccgcccgcaccgcctaccccctgctg
atcgccgagctggccaagcgctccccggaggagccgcaccgccagtacctgctgtatgtg
gccgagcgcatcgccgccacgcgcgcccggcacgccgacatggcctaccgctccccggag
gagctgctggccgacctgcgcctggtgcaggagtcgctggccggcgccggggccgtccgg
caggcctacggggagctgcagcacctgatctggcagaccgagacgttcgggttccacctg
gccgagctggagatccgccagcactcgcaggtgcacgaaaaggccctggccgaggtccgg
gcgggcggggcgctcagcgagatgaccgaggaggtcctcgacaccctccgcgtcgtctcc
tggatccagcggcgcttcggggtgcgggcctgccaccgctatgtggtctccttcacccgc
tcggccgacgacatcgccgccgtctacgagctggccgaatccctgggcgaccacgccccc
gtcctggacgtggtgcccttgttcgaaaccggcgaggacctggaccgggccccgtcggtg
ctggagggcatgctcaagctgccggcggtgcagcgccggctggccgagaccgggcggcgg
ctggaggtcatgctcggctactcggactcggccaagcagctcggccccaccagcgccacg
ctgcggctgtatgacgcgcaggcggcgctggcggcctgggccgcccgcaacggcatcacc
ctcaccctcttccacggccgcggcggctcgctgggccgcggcggcggcccggccaaccgg
gcgatcctggcgcaggcgcccggctcggtgaacggccggttcaaggtcaccgagcagggc
gaggtcatcttcgcccgctacggccagcgcgagatcgccaagcggcacatcgaacaggtc
accaacgcgatcatgctggcctccactccggcggtggaggcccgcgcccacgaggccgcc
gtgcgcttccgcccgctggccgaccggatcagcgccgccgcccaggccgccttccgcgcc
ctgatcgagaccgagggcttcgccgagtggttcgcccgggtcagcccgctggaggagatc
tcccggctgcgcatcggctcccgtccggcgcgccgcaccgccacccgcagcctggaggac
ctgcgcgccatcccctgggtgttcgcctggacccagacccgggtcaacctgcccggctgg
tacgggctgggcagcggcctggaggcggtgctcggcggcggggacgacgaggcggggctg
gcggagctgcaggaggcctaccggtcctggccgctgtttgcggtgatgctcgacaacgcc
gagatgagcctggccaaggccgaccgcgccatcgccgagcgctacctggcgctgggcggc
cgtccggagctgaccgagcgggtgctggccgagtacgaccgcacccgctccctggtgctg
gcggtcaccgggcaccggcggctgctggagaaccggcgggtgctctcccgcgcggtcgaa
ctgcgcaacccctatgtggacgccctgtcgctgctgcagctgcgggcgctgaccgcgctg
cgggagggcgtggccgacgacgccgaacgcgcccgcctggaggagctgctgctgctgtcg
gtcaacggcgtggccgccgggctgcagaacaccggctga

DBGET integrated database retrieval system