KEGG   Thermomonospora curvata: Tcur_4210Help
Entry
Tcur_4210         CDS       T01127                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
tcu  Thermomonospora curvata
Pathway
tcu00020  Citrate cycle (TCA cycle)
tcu00480  Glutathione metabolism
tcu01100  Metabolic pathways
tcu01110  Biosynthesis of secondary metabolites
tcu01120  Microbial metabolism in diverse environments
tcu01130  Biosynthesis of antibiotics
tcu01200  Carbon metabolism
tcu01210  2-Oxocarboxylic acid metabolism
tcu01230  Biosynthesis of amino acids
Module
tcu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tcu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:tcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tcur_4210
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Tcur_4210
Enzymes [BR:tcu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Tcur_4210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ACY99737
UniProt: D1A284
LinkDB All DBs
Position
complement(4807594..4808817)
Genome map
AA seq 407 aa AA seqDB search
MPKIKVAGPVVELDGDEMTRIIWKFIKDQLILPYLDIDLKYYDLGIQNRDATDDQVTVDA
ANAIKKYGVGVKCATITPDEARVEEFGLKQMWRSPNGTIRNILGGVVFREPIIVSNIPRL
VPGWTKPIVIGRHAHGDQYKATDFKVPGPGTLTITYTPDDGSEPIQFEVARYPEGGGVAM
GMYNFRKSIEDFARASFRYGLDRNYPVYLSTKNTILKAYDGMFKDVFAEIYENEFKEEFE
ARGLTYEHRLIDDMVACALKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDG
RTVEAEAAHGTVTRHYRLHQQGKPTSTNPIASIFAWTRGLAHRGKLDNTPEVIKFAETLE
QVCIETVESGQMTKDLALLISKDQPWLTTQEFLHALDVNLQKKINEK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagatcaaagtagcgggcccggtcgtcgaactcgacggcgatgagatgacgcgg
atcatctggaaattcatcaaggaccagctgatcctgccttacctggacatcgacctgaag
tactacgacctgggcatccagaaccgcgacgccaccgacgaccaggtcaccgtggacgcc
gccaacgccatcaagaagtacggcgtcggcgtcaagtgcgccaccatcacccccgacgag
gcccgggtggaggagttcgggctcaagcagatgtggcgctcgcccaatggaacgatccgt
aacatcctgggcggcgtggtcttccgcgagccgatcatcgtctccaacatcccgcgcctg
gtgcccggctggaccaagcccatcgtcatcggccgtcacgcccacggcgatcagtacaag
gccaccgacttcaaggtgcccggccccggcaccctgacgatcacctacacccccgacgac
ggctccgagcccatccagttcgaggtcgcccgctaccccgagggcggcggcgtcgcgatg
ggcatgtacaacttccgcaagtccatcgaggacttcgcccgcgcctcgttccgctacggc
ctggaccgcaactacccggtctacctgtcgaccaagaacacgatcctcaaggcctacgac
ggcatgttcaaggacgtgttcgccgagatctacgagaacgagttcaaggaggagttcgag
gcccgcggcctgacctacgagcaccgcctgatcgacgacatggtcgcctgcgccctcaag
tgggagggcggctacgtgtgggcctgcaagaactacgacggcgacgtgcagtccgacacc
gtggcccagggcttcggctcgctcggcctgatgacctcggtgctgatgacccccgacggc
cggaccgtggaggccgaggccgcccacggcacggtcacccgccactaccggctgcaccag
cagggcaagcccacctccaccaacccgatcgcctcgatcttcgcctggacccgcggcctg
gcccaccgcggcaagctggacaacacccccgaggtcatcaagttcgccgagaccctggag
caggtctgcatcgagacggtcgaatccgggcagatgaccaaggacctggcgctgctgatc
agcaaggaccagccctggctgaccacccaggagttcctgcacgcgctggacgtcaacctc
cagaagaagatcaacgaaaagtga

DBGET integrated database retrieval system