KEGG   Thermomonospora curvata: Tcur_4251Help
Entry
Tcur_4251         CDS       T01127                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
tcu  Thermomonospora curvata
Pathway
tcu00564  Glycerophospholipid metabolism
tcu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tcu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Tcur_4251
Enzymes [BR:tcu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Tcur_4251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 GIDA NAD_binding_8 3HCDH_N Pyr_redox Thi4 AlaDh_PNT_C DUF3362 HI0933_like
Motif
Other DBs
NCBI-ProteinID: ACY99778
UniProt: D1A308
LinkDB All DBs
Position
complement(4852872..4854605)
Genome map
AA seq 577 aa AA seqDB search
MAGSPITGLGSSRLGPAERAQALDRMATEEFDVVVVGGGIVGAGAALDAATRGLSVALVE
ARDFASGTSSRSSKLIHGGLRYLEQHNFDLVREALTERGLLLQRIAPHLVRPVPFLLPTT
RRFWERGYLGAGVALYDALAFQMGSTRGVPHHRHLSRRKALKLAPALRKDALVGAIQYWD
AQVDDARYVVTVLRTAAQYGAQIAPRTQCIGFLREGERVTGLRILDLESGHKSEVRARQV
VNATGVWTDDIQELVGGRGQIHVKASKGVHLVVPKDRIHSSTGIILRTEKSVLFVIPWGR
HWIIGTTDTAWNLDKVHPAASKADIDYVLSKVNEVLVTPLTHDDVEGVYAGLRPLLTGET
EETSKLSREHVVAHPVPGLVLVAGGKYTTYRVMAKDAIDAVVHGLDRRVAESCTDRIALV
GGEGFQAMWNARQRLADRSGLHVARIEHLLQRYGTLIDDLLEMIAERPDLGKPLTGADDY
LRAEVVYAATHEGARHLNDVLSRRTRISIEAWDRGVGVAQEAAELLAPVLGWSKDQIDRE
VEYYRKRVEAERDSQNQEDDQEADARRRGAPEIVPTY
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggccggatcaccgatcaccggattgggcagttcacgactgggtcccgccgagcgcgcc
caggccctggaccgaatggccaccgaggagttcgacgtcgtcgtggtgggcggcggcatc
gtgggcgcgggcgccgcgctggacgccgccacccggggcctgtcggtggcgctggtggag
gcccgcgacttcgcctccggcacctcctcccgctcctccaagctcatccacggcgggctg
cgctacctggagcagcacaacttcgacctggtccgcgaggcgctgaccgagcgcggcctg
ctgctgcagcgcatcgcgccgcacctggtgcgcccggttcccttcctgctgcccaccacc
cgccgcttctgggagcgcggctacctgggcgccggggtggccctttacgacgcgctggcg
ttccagatgggcagcacccggggcgtgccccaccaccggcacctgagccgccgcaaggcg
ctcaagctggccccggcgctgcgcaaggacgccctggtcggggcgatccagtactgggac
gcccaggtcgacgacgcccgttatgtggtgaccgtgctgcgcaccgccgcccagtacggc
gcgcagatcgccccccgcacccagtgcatcgggttcctgcgcgagggcgagcgggtcacc
ggcctgcggatcctggacctggagtccgggcacaagagcgaggtccgcgcccgccaggtg
gtcaacgccaccggggtgtggaccgacgacatccaggagctggtgggcggacgcggccag
atccacgtcaaggcgtccaagggcgtccacctggtggtgcccaaggaccgcatccactcc
tccaccggcatcatcctgcgcaccgagaagtcggtgctgttcgtcatcccgtggggacgg
cactggatcatcggcaccaccgacaccgcctggaacctcgacaaggtccacccggcggcc
tccaaggccgacatcgactatgtgctgtcgaaggtcaacgaggttttggtgaccccgctg
acccatgacgacgtcgagggcgtctacgccgggctgcggccgctgctgacgggggagacc
gaggagacctccaagctgtcgcgcgagcacgtggtcgcccacccggtgcccggcctggtc
ctggtcgccggcggcaagtacaccacctaccgggtgatggccaaggacgccatcgacgcg
gtggtgcacggcctggaccgccgggtcgccgagtcctgcaccgaccgcatcgccctggtc
ggcggggagggcttccaggccatgtggaacgcccggcagcgcctggccgaccgctccggg
ctgcacgtggcccgcatcgagcacctgctgcagcgctacggcaccctcatcgacgacctg
ctggagatgatcgccgagcgtcccgacctgggcaagccgctgaccggcgccgacgactac
ctgcgcgccgaggtggtctacgccgccacccacgagggcgcccgccacctcaacgacgtg
ctgtcgcgccgcacccgcatctccatcgaggcctgggaccgcggcgtcggcgtcgcccag
gaggccgccgaactcctcgcccccgtcctgggctggtccaaggaccagatcgaccgcgag
gtcgagtactaccgcaagcgggtcgaggccgaacgcgactcccaaaaccaagaagacgac
caggaggccgacgcccgccgccgcggcgccccggagatcgtccccacctactga

DBGET integrated database retrieval system