KEGG   Hydrogenovibrio crunogenus: Tcr_0839Help
Entry
Tcr_0839          CDS       T00296                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
tcx  Hydrogenovibrio crunogenus
Pathway
tcx00630  Glyoxylate and dicarboxylate metabolism
tcx01100  Metabolic pathways
tcx01120  Microbial metabolism in diverse environments
tcx01200  Carbon metabolism
Module
tcx_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:tcx00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Tcr_0839
Enzymes [BR:tcx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Tcr_0839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ABB41435
UniProt: Q31HD8
LinkDB All DBs
Position
918390..918734
Genome map
AA seq 114 aa AA seqDB search
MSISQIDDYRTQYTLETFSFLPELTADEIYDQIVYIINQGWSPALEHEEPAKASDHYWGM
WKLPMFGTRDPNEVLAEIDACRQAYPNHLIRLVGYDNYTQCQGHNFVVYRPRGM
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatttcacaaatagatgattaccgtacacagtacacattagaaactttctcgttt
cttccagaactgacggctgatgaaatttacgatcaaatcgtttacatcatcaaccaaggt
tggtcgccggcacttgaacatgaagagccagcaaaagcatcagatcattactggggtatg
tggaagttgccaatgtttggtacacgcgatccaaatgaagttttggctgagattgatgct
tgtcgtcaagcttacccaaatcacttgatccgtttggttgggtatgacaactatactcag
tgccaaggtcacaactttgtggtttatcgcccacgtggcatgtaa

DBGET integrated database retrieval system