KEGG   Hydrogenovibrio crunogenus: Tcr_1264Help
Entry
Tcr_1264          CDS       T00296                                 

Definition
(GenBank) acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Organism
tcx  Hydrogenovibrio crunogenus
Pathway
tcx00061  Fatty acid biosynthesis
tcx00620  Pyruvate metabolism
tcx00640  Propanoate metabolism
tcx01100  Metabolic pathways
tcx01110  Biosynthesis of secondary metabolites
tcx01120  Microbial metabolism in diverse environments
tcx01130  Biosynthesis of antibiotics
tcx01200  Carbon metabolism
tcx01212  Fatty acid metabolism
Module
tcx_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:tcx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tcr_1264
   00640 Propanoate metabolism
    Tcr_1264
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Tcr_1264
Enzymes [BR:tcx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     Tcr_1264
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Tcr_1264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACCA Carboxyl_trans ECH_1
Motif
Other DBs
NCBI-ProteinID: ABB41859
UniProt: Q31G64
LinkDB All DBs
Position
complement(1379206..1380162)
Genome map
AA seq 318 aa AA seqDB search
MKLDFLDFEQPIAELEAKIDELRHLDGQDMDLIKEVSALEQKSKNLTQSIFNRLSDVQVA
QVARHPQRPYMLDYLKEMFTDFKEMHGDRAFADDAAIVGGLARINGQAVMVIGQEKGRDT
KEKIRRNFGMPRPEGYRKALRLMKTAETFGLPVLTFIDTPGAYPGINAEERGQSEAIARN
LIEMSELKVPVICTVIGEGGSGGALAIGVGDVTMMMQYSTYSVISPEGCASILWKDAANA
ADAASALGITAPRLKELGLVDEIVEEPLGGAHRNPSAAASSLKDAILRQLELLKNKPVDE
LLETRYQRYMQYGNFDVA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagattttttagattttgaacaaccaattgctgaattggaagccaaaattgat
gagttgcgtcacttggatggtcaagatatggacctgattaaagaagtgtctgcgttagaa
caaaaaagtaaaaatttaacccagtcaatttttaatcgtttgtctgatgtgcaagttgct
caggtggcgcgtcatccacagcgtccatacatgttggattatctaaaagaaatgttcact
gattttaaagaaatgcatggcgatcgtgcctttgcagatgatgctgcgattgtgggtggt
ttggcgcgcattaatggtcaagcggtcatggtaattggccaggaaaaaggtcgtgacacc
aaagaaaaaatccgtcgtaatttcgggatgccacgcccagaagggtatcgcaaagcattg
cgtttaatgaaaacggctgagacgttcggcttgccggttcttacatttatcgatacgcca
ggcgcttacccagggattaatgcggaagagcgcggtcagtcggaagccattgctcgtaat
ttgattgaaatgtcagaattgaaagtaccggttatctgtaccgttattggtgaagggggg
tctggtggtgccttggcaatcggtgttggagacgttacgatgatgatgcaatacagcact
tactcggttatttcgccagaagggtgtgcttctattttatggaaagatgcggctaatgct
gcagatgctgcgagtgcgttgggtattaccgcgccacgcttgaaggagcttggcctggtt
gatgaaattgttgaagagccactgggtggggcacatcgcaacccttccgccgcggcctct
tctctaaaagacgcgattttaagacagctggaattgttaaaaaacaaacctgttgatgaa
ctgcttgaaacgcgttatcagcgttacatgcaatacggtaactttgacgttgcctaa

DBGET integrated database retrieval system