KEGG   Hydrogenovibrio crunogenus: Tcr_1275Help
Entry
Tcr_1275          CDS       T00296                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
tcx  Hydrogenovibrio crunogenus
Pathway
tcx00061  Fatty acid biosynthesis
tcx00780  Biotin metabolism
tcx01100  Metabolic pathways
tcx01212  Fatty acid metabolism
Module
tcx_M00083  Fatty acid biosynthesis, elongation
tcx_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:tcx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Tcr_1275
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Tcr_1275
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:tcx01004]
    Tcr_1275
Enzymes [BR:tcx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     Tcr_1275
Lipid biosynthesis proteins [BR:tcx01004]
 Fatty acid synthase
  Component type
   Tcr_1275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas Triabin
Motif
Other DBs
NCBI-ProteinID: ABB41870
UniProt: Q31G53
LinkDB All DBs
Position
complement(1390445..1390891)
Genome map
AA seq 148 aa AA seqDB search
MTNMLNVKEIFEYLPHRYPFLLVDRVTEFKSGESLKAYKNVTYNEPQFTGHFPDNPIMPG
VMIIEAMAQCTGILAFKTQDVKPDGTSMYYLAAVDNCRFRKPAIPGDKLEFEVKTVNNKK
GIWKFECTTSVDGKLIASCDMLCAERKV
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgactaacatgttgaatgtaaaagaaatatttgaatatctgcctcatagatatcctttt
ttattagtagatcgtgtgactgaatttaaatcgggtgaatccttaaaagcctataaaaac
gtgacttataatgagccgcagttcacaggtcattttcctgataatccgatcatgccaggg
gttatgatcattgaagccatggcacaatgtacaggcattcttgcctttaaaacgcaagat
gtaaagcctgatggtacttcaatgtattaccttgcagcggttgataattgtcgttttaga
aaaccggccattcctggtgacaaactagaatttgaggtaaagacggttaacaataaaaaa
ggcatttggaaatttgagtgtacaaccagcgttgacggaaagttaatcgcttcttgcgat
atgctatgtgctgagcgcaaagtttaa

DBGET integrated database retrieval system