KEGG   Thiomicrospira cyclica: Thicy_0877Help
Entry
Thicy_0877        CDS       T01517                                 

Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
tcy  Thiomicrospira cyclica
Pathway
tcy00020  Citrate cycle (TCA cycle)
tcy00190  Oxidative phosphorylation
tcy00650  Butanoate metabolism
tcy01100  Metabolic pathways
tcy01110  Biosynthesis of secondary metabolites
tcy01120  Microbial metabolism in diverse environments
tcy01130  Biosynthesis of antibiotics
tcy01200  Carbon metabolism
Module
tcy_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tcy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Thicy_0877
   00650 Butanoate metabolism
    Thicy_0877
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Thicy_0877
Enzymes [BR:tcy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Thicy_0877
    1.3.5.4  fumarate reductase (quinol)
     Thicy_0877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO FAD_binding_3 HI0933_like GIDA Thi4 FAD_oxidored Lycopene_cycl Pyr_redox_3 NAD_binding_8 NAD_binding_7 Pyr_redox ApbA
Motif
Other DBs
NCBI-ProteinID: AEG31649
UniProt: F6DCR3
LinkDB All DBs
Position
1035860..1037695
Genome map
AA seq 611 aa AA seqDB search
MPHSVADDTCPPLHRHRYDVLIVGAGGAGLRAALELQRAGKQVALISKVYPTRSHTVAAQ
GGINAALGNISEDNWHWHMFDTIKGSDYLGDQDAIEYMCQQAPRIVRELEHFGVPFSRLD
DGKIYQRPFGGQSQHFGQSQATRTCAVADRTGHAILHTLYQQNLAAGTQIFSEFFSLDLI
LEDQRVVGLVALEIATGQWHQFQADAVLLATGGAGQIYRTNTNASINTGDGLAMVLRAGL
PLMDMEFWQFHPTGVAGRGMLISEAARGEGGILRNGLGDAFMANYAPKVKDLASRDIVSR
AIATEIHQGRGCGPNKDYIELDLTHLDAELIKQKLPGIREISLTFTGIDPITQPIPIHPS
CHYMMGGIPTNLHGQVMTQVTSDANGENQPVAGLYAIGECACVSVHGANRLGGNSLLDIV
VFGKAAAEHILNQTETRTETAAPAKLSNLTIPESIIARMAAYQADKPKTNSGDNHDSVVT
FKRDLQKIMQRHCGVFRDQTTLVAARSKLAELEQRLLSLPLHDPAQAFNLERIQAFECEN
LLAVAWATLESAIARTESRGAHARDDFPDRDDQAWLVHLLFFNQPERRLSQKPVQQQPKT
VAAFPPIKRVY
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgccccattcagtcgccgatgacacttgcccgccgctacaccggcatcgttatgatgtg
ctcattgtcggtgccggcggtgccggattacgcgccgccctcgaactccagcgtgctggt
aaacaggtcgcactgatttccaaagtctatcccacccgctcgcacaccgtggcggcacag
gggggtattaatgcggccttaggtaatatcagcgaagacaactggcactggcatatgttc
gataccatcaaaggcagtgattatttgggcgaccaggatgcgattgaatacatgtgccaa
caagcaccgcgaatcgtgcgcgaactcgagcactttggtgtgcctttttcgcggctcgac
gacggtaaaatttaccagcgtccgtttggtggacaaagccagcattttggtcaaagccaa
gcgacccgaacctgcgcggtggctgaccgcaccggccatgctattttgcacacgttgtat
cagcaaaacctagccgctggcacccaaattttcagtgaatttttcagcctggatttaatc
ctcgaagatcaacgtgtggtgggtttggtggcactggagattgctaccggccagtggcat
cagtttcaagccgatgcggtattactggctaccggtggtgcgggtcaaatttatcgcact
aacaccaacgccagcattaataccggcgatggcctagcgatggtgttacgcgccggcctg
ccgctgatggatatggagttttggcaattccaccccaccggtgtagccggtcgcggtatg
ctgatttctgaagcggcacgaggtgaaggcggtattttgcgcaacggattgggcgacgcc
tttatggccaactacgcccccaaggtcaaggatctcgcctcgcgtgatatcgtttctcgg
gcgattgccactgaaatccaccaaggtcgcggttgtggccctaacaaagactatattgaa
ttggatctcacccacctcgatgccgagctgattaaacaaaaactgcccggcattcgggag
atcagcctcacctttactggcatcgacccgattacccaacccatcccgattcacccgtct
tgccactatatgatgggcggcattccgaccaatttgcatggccaggtgatgactcaggtg
acaagtgatgcgaacggcgaaaaccagccagttgcggggctctatgcgattggcgaatgt
gcctgtgtgtcggtgcatggtgccaatcgcctcgggggcaactcgctgctggatatcgtg
gtatttggcaaagccgccgccgaacatattctgaatcaaactgaaactcgaaccgaaaca
gccgcaccggctaagctctctaacctaacaatacccgagtcaatcatcgcgcgcatggcg
gcttatcaagcagacaagcccaaaaccaacagcggtgataatcacgactcggtggtcacc
tttaaacgcgacttgcaaaagattatgcaacgccattgcggagtatttcgagaccagaca
accctagttgccgcgcgatccaaactggctgaactcgaacaacggctgctatccttgccg
ctacacgacccagcacaggcgtttaatctcgaacgtatccaagcctttgagtgtgaaaat
ctgctcgccgtggcctgggccaccttagaaagtgccattgcccgcaccgaaagtcgcggt
gcccatgcgcgtgatgacttccccgaccgcgatgaccaggcctggttagtccatttactg
ttttttaatcagcccgaacgccgtctcagtcaaaaaccggtgcaacagcaacccaaaacg
gttgcagcgtttccgccgattaaacgggtgtattaa

DBGET integrated database retrieval system