KEGG   Thiomicrospira cyclica: Thicy_0878Help
Entry
Thicy_0878        CDS       T01517                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
tcy  Thiomicrospira cyclica
Pathway
tcy00020  Citrate cycle (TCA cycle)
tcy00190  Oxidative phosphorylation
tcy00650  Butanoate metabolism
tcy01100  Metabolic pathways
tcy01110  Biosynthesis of secondary metabolites
tcy01120  Microbial metabolism in diverse environments
tcy01130  Biosynthesis of antibiotics
tcy01200  Carbon metabolism
Module
tcy_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tcy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Thicy_0878
   00650 Butanoate metabolism
    Thicy_0878
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Thicy_0878
Enzymes [BR:tcy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Thicy_0878
    1.3.5.4  fumarate reductase (quinol)
     Thicy_0878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer4_4 Fer2 Fer4_7 Fer4_9
Motif
Other DBs
NCBI-ProteinID: AEG31650
UniProt: F6DCR4
LinkDB All DBs
Position
1037726..1038460
Genome map
AA seq 244 aa AA seqDB search
MKENSVLFKIQRYQPESAAEPAAQAAQPYWQEMTLDEAQISPGMMLLDALKLLREQDSTL
SFRSSCQEGVCGSDAMQVNGRNRLSCITPLAELRQPIELMPVPGLPILRDLIVDMTLFFD
RYAQANPTLNAGEFNPEQEHLQSPEDRAKLDGLYECILCACCSTSCPSFWWHPDQFLGPA
ALLAAERVVIDSRDIQPKQRLDALSDPYQLHRCRGIQQCTASCPKGLDPSRAIRQLKHQQ
WTQS
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaactcagtgctgtttaaaattcaacgctaccaacccgaaagtgcagccgag
ccagccgcacaagctgcacaaccctactggcaagaaatgaccctggatgaagcacaaatc
agccccggcatgatgctcctggatgcactcaaactcttgcgcgaacaagactcaacactc
agctttcgtagctcctgccaagaaggcgtgtgcggctcggatgcgatgcaggtcaatggg
cgcaatcgcctcagttgcatcacgccactggccgaattacgccaaccgatagaactaatg
ccggtaccaggcctgccgattctgcgtgatttaattgtcgatatgacgctgttttttgat
cgctacgcccaagccaatcccaccctaaatgctggtgaatttaatcccgaacaggagcat
ctacaaagcccggaagatcgggccaaactcgatggtctttatgaatgtatcctttgcgcc
tgttgcagtaccagttgcccgtcgttttggtggcatcccgatcagtttttgggacccgcc
gcgctgttagccgccgaacgggtagtgatagattcacgtgatattcaacccaaacaacga
ctcgacgccctcagcgatccctatcaattgcatcgttgtcgggggattcagcaatgcacc
gccagttgtccaaaaggcctcgacccgagtcgcgcgattcgtcaactcaaacaccaacaa
tggacgcaatcctaa

DBGET integrated database retrieval system