KEGG   Thiomicrospira cyclica: Thicy_0961Help
Entry
Thicy_0961        CDS       T01517                                 

Definition
(GenBank) (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
tcy  Thiomicrospira cyclica
Pathway
tcy00061  Fatty acid biosynthesis
tcy00780  Biotin metabolism
tcy01100  Metabolic pathways
tcy01212  Fatty acid metabolism
Module
tcy_M00083  Fatty acid biosynthesis, elongation
tcy_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:tcy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Thicy_0961
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Thicy_0961
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:tcy01004]
    Thicy_0961
Enzymes [BR:tcy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     Thicy_0961
Lipid biosynthesis proteins [BR:tcy01004]
 Fatty acid synthase
  Component type
   Thicy_0961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: AEG31728
UniProt: F6DCZ2
LinkDB All DBs
Position
complement(1105636..1106073)
Genome map
AA seq 145 aa AA seqDB search
MLDIKEIFDYLPHRYPFLLVDRVTEIELGVSLKAYKNITFNEPQFTGHFPNNPIMPGVMI
VEAMAQCTGILAFKTQEKKSDGSTMYYLAAIDNCRFRQPAVPGDRLDFSVVTTGQKRGIW
KFECETRIDGKVIASADLMCAERKV
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgctagatataaaagaaatattcgattacttgccgcaccgttatccctttctattagtt
gaccgcgtgaccgagatagaactgggtgtatcactaaaagcctataaaaacatcactttt
aacgaaccacaattcaccgggcactttccaaataatccgattatgcccggtgtgatgatt
gtcgaagccatggctcaatgtaccggaatattagcattcaaaacgcaagaaaaaaaatca
gatggcagtaccatgtattatttagcagcaatcgataactgccgttttcgacaacctgca
gttcctggtgaccgccttgatttttcagtggtcaccaccggtcaaaaacgggggatctgg
aaatttgaatgcgaaacccgcattgatggcaaggtcattgcctcagcggatctgatgtgt
gccgagcgtaaggtgtaa

DBGET integrated database retrieval system