KEGG   Treponema denticola: TDE1697Help
Entry
TDE1697           CDS       T00157                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tde  Treponema denticola
Pathway
tde00010  Glycolysis / Gluconeogenesis
tde00260  Glycine, serine and threonine metabolism
tde00680  Methane metabolism
tde01100  Metabolic pathways
tde01110  Biosynthesis of secondary metabolites
tde01120  Microbial metabolism in diverse environments
tde01130  Biosynthesis of antibiotics
tde01200  Carbon metabolism
tde01230  Biosynthesis of amino acids
Module
tde_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tde_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TDE1697 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    TDE1697 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TDE1697 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tde04131]
    TDE1697 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tde04147]
    TDE1697 (gpmA)
Enzymes [BR:tde01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     TDE1697 (gpmA)
Membrane trafficking [BR:tde04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    TDE1697 (gpmA)
Exosome [BR:tde04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   TDE1697 (gpmA)
  Exosomal proteins of melanoma cells
   TDE1697 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 2740869
NCBI-ProteinID: NP_972301
UniProt: Q73M14
LinkDB All DBs
Position
complement(1755606..1756349)
Genome map
AA seq 247 aa AA seqDB search
MRLVLVRHGESEWNKLNLFTGWTDVDLSEKGVEEAKEGGTYLKKEGFDFDICYTSYLKRA
IHTLNYILSQMDREWLPVIKTWKLNERHYGGLQGLNKAETAEKYGEDQVKIWRRSFDIAP
PVLEEGDKRCPYLQEQYRGIEKSELPLTESLKDTIARAVPFFEKTIKPQMLEGKRILITA
HGNSLRALVKYFENLSDEEIISVNIPTGVPLVYEFDKNFKVLSKRYLGDQEKINAKINAV
ANQGKKK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgagattggttttggtaaggcatggtgaaagtgaatggaataagcttaatttatttacc
ggctggacggatgtcgatttaagcgaaaagggtgtagaagaagcaaaagaaggcggaacc
tatttaaaaaaagaaggttttgacttcgatatttgctatacatcctatctaaaacgagca
attcataccctcaattatattttaagccagatggatagagaatggcttcctgtcataaaa
acttggaaacttaatgaaaggcattacgggggcttgcagggcctaaacaaggcggaaaca
gccgaaaaatacggagaagatcaggtaaaaatttggcgccgttcctttgatattgctcct
cccgttttggaagaaggagataagcgctgcccctatttgcaggaacagtacaggggtatt
gaaaaatcagagctccccttaaccgaaagcttaaaagataccatagccagagccgttcct
ttttttgaaaagactataaaacctcaaatgctagaaggaaaaaggattcttatcacagcc
cacggtaattccctcagggccttggttaaatattttgaaaatttaagcgatgaagaaata
atctcggtaaatattccgacaggcgttcctttggtttacgaattcgataagaattttaag
gttcttagtaaacgctaccttggagatcaagagaaaatcaatgctaaaataaatgcagtt
gcaaatcaaggaaaaaagaaataa

DBGET integrated database retrieval system