KEGG   Tenacibaculum dicentrarchi: AUW17_00950Help
Entry
AUW17_00950       CDS       T04208                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
tdi  Tenacibaculum dicentrarchi
Pathway
tdi00240  Pyrimidine metabolism
tdi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tdi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    AUW17_00950
Enzymes [BR:tdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     AUW17_00950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: ALU73948
UniProt: A0A0U3J5M8
LinkDB All DBs
Position
complement(222487..223098)
Genome map
AA seq 203 aa AA seqDB search
MFLENTVNHTGQFGWIEVICGSMFSGKTEELIRRLKRAEFAKQRVEIFKPTIDTRYDNQQ
VVSHNATKIRSTPVPCSSNILLLANNVDVVGIDEAQFFDSGIVAVSNELANRGVRVIVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAVCTHTGNLAHYSHRKAASDDLVLLGEVQEYEP
LSRAAYYKAVQEQHKKNENLSDE
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcgaaaatacagtaaatcatacagggcaatttggttggattgaagtaatatgt
ggttcaatgttttcaggaaaaactgaagaattaatccgcagacttaaacgtgccgaattt
gcaaaacaacgtgttgaaatttttaaaccaactatagatactcgttatgacaatcaacaa
gtagtatctcataatgcgaccaaaattagatcaactcccgttccttgttcttccaatatc
ttattactagcaaacaatgttgatgttgttggtattgatgaagcacaattttttgactca
ggcatcgttgctgtttctaatgaactagccaatagaggtgttcgagttattgtggcaggt
ttagatatggattttaaaggaaatccttttggcccaatgcccgctttaatggctaccgca
gaatatgttacaaaagtacatgctgtttgcacacatacgggtaacttagcacattatagt
catcgaaaagcagccagtgatgaccttgtcttattaggtgaagtacaagaatacgagcct
ttaagcagagctgcttattacaaagctgtgcaagaacaacataaaaagaacgaaaattta
tccgatgaataa

DBGET integrated database retrieval system