KEGG   Torulaspora delbrueckii: TDEL_0B03850Help
Entry
TDEL_0B03850      CDS       T02236                                 

Gene name
TDEL0B03850
Definition
(RefSeq) hypothetical protein
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
tdl  Torulaspora delbrueckii
Pathway
tdl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tdl01100  Metabolic pathways
tdl01110  Biosynthesis of secondary metabolites
tdl01130  Biosynthesis of antibiotics
tdl01230  Biosynthesis of amino acids
Module
tdl_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:tdl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TDEL_0B03850 (TDEL0B03850)
Enzymes [BR:tdl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     TDEL_0B03850 (TDEL0B03850)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-GeneID: 11504593
NCBI-ProteinID: XP_003679725
UniProt: G8ZPH0
LinkDB All DBs
Position
2:692173..693255
Genome map
AA seq 360 aa AA seqDB search
MFPANGSQEPSEDVRILGYDPLVSPALLQVQVPATEVSLETAKRGRKEAGEIIAGRDDRV
LVIVGPCSIHDLDAAQEYAARLKKLSDELKGELCIIMRAYLEKPRTTVGWKGLINDPDVN
NSYNINKGLQSARQLFVNLTSTGVPIGSEMLDTISPQYLADLLSFGAIGARTTESQLHRE
LASGLSFPVGFKNGTDGTLGVAVDAVQAASHSHHFMGVTKHGVAAITTTKGNEKCFVILR
GGKKGTNYDAKSVAEAKAQLPAGSNGLMIDYSHGNSNKDFRNQPKVNDAVCEQISNGEKA
IVGVMIESNINEGAQKIPPEGKAGLKYGVSITDACISWETTVDVLTKLAAAVRQRREHYK
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtttccagcaaacggttctcaagaaccaagtgaggatgtcagaatcttgggctacgac
ccattggtctctccagctttgttacaggttcaagtaccagccactgaagtatctttggag
accgctaagagaggtagaaaagaagctggtgagatcatcgccggcagagatgacagggtc
ctggtcattgttggaccttgttctatccacgatttggatgcagcccaggaatatgccgct
aggttaaagaaactatctgatgaattgaaaggtgaactgtgtattatcatgagagcttac
ctggaaaaaccaagaactactgttggctggaagggtttaatcaatgatccagatgttaac
aacagttacaacattaacaaaggtctgcagtccgccaggcaattgtttgtcaatttgact
agtactggtgtgccaattggttccgaaatgttggacaccatctctcctcaatacttggcc
gatctattgtccttcggtgccatcggtgccagaactactgagtcccaactccatagagaa
ctagcatctggtctatcattcccagtcggtttcaagaacggtaccgatggtactttgggt
gttgctgtcgacgctgttcaagctgcttcgcattctcaccactttatgggtgtcaccaag
catggtgtcgcagctatcactactaccaaaggtaacgaaaagtgtttcgttattctaaga
ggtggtaagaaaggtaccaactacgatgccaagtccgtcgctgaagccaaggcccaacta
cccgctggttcaaacggtttgatgatcgactactctcacggtaactccaacaaagatttc
agaaaccaaccaaaagtaaacgatgccgtttgtgaacaaatttctaacggtgaaaaggcc
attgttggtgtcatgatcgaatctaacatcaacgaaggtgctcaaaagatcccaccagag
ggtaaagccggtttgaagtacggtgtgtccatcactgatgcctgtataagttgggaaacc
acagtcgatgtcttgactaagctagctgctgctgtcagacagagaagagaacactacaaa
tga

DBGET integrated database retrieval system