KEGG   Torulaspora delbrueckii: TDEL_0C03860Help
Entry
TDEL_0C03860      CDS       T02236                                 

Gene name
TDEL0C03860
Definition
(RefSeq) hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
tdl  Torulaspora delbrueckii
Pathway
tdl00500  Starch and sucrose metabolism
tdl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tdl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TDEL_0C03860 (TDEL0C03860)
Enzymes [BR:tdl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     TDEL_0C03860 (TDEL0C03860)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 11500610
NCBI-ProteinID: XP_003680486
UniProt: G8ZRY3
LinkDB All DBs
Position
3:complement(674841..676649)
Genome map
AA seq 602 aa AA seqDB search
MKGSINGSHRGSKHALSVLTLIIIISLIAYRFFLPLESELQVARAPWSFEDEDRNVTIVD
FFKPFDSAHPTSLPLKDYYRKINLKPVAPYSINRANFSEWVDVQCESSFERLLQNVADSE
LNGDHLVSEGVVEGVVIASPSKSAPDYFYQWVRDAAITMHTVVNNLFPVTVAPYDAGAGA
VNVTLARTVLKYVNNSYVLQRSDNPSGQGVDGQDGNPLRGLGEPKWLVDNKPFTQNWGRP
QNDGPPLRSLTIFTLLHELALNGVALEDIIEKCGFGADLIFRNDTELFEQIIYWDLRFIM
FNWKEDSFDLWEEVNGKHFFTSLVQFTSIKMAISFLEKSENEWTRFDKQVLLQDLRKCLN
DMAQFLTFDSGFINPNKNYIVETPSVLNQRCGLDIAVIIGSLLTHAENFDVGVPFGVTDT
GVLNTLYSLVKSMGVIYPINHQRAPLNIGVALGRYPEDIYDGVGTSEGNPWFLATSAAPE
LLYRLILENYKLQRDLVIPLNRWESEFWTLVFDGFQHYTDQEYQLVIPWGSPAFGQTMTA
VFDLGESFLDKMREHVSDAGEMSEQFNKYTGYLQGAHDLTWSYGALWSTCHARKQVLPLV
SA
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgaagggctcgataaacggttcccaccgtggttccaaacatgcgttgtccgttctcaca
ttaattattattatatctcttattgcgtatcgttttttcctgccgctcgaatcggagttg
caggttgcaagagcgccttggagttttgaagatgaagatagaaatgttacgatagtggat
ttttttaaaccctttgactccgcgcatccaacttcgcttcctttgaaagactactataga
aagattaatttaaagccagtggccccttatagtattaatagggctaatttcagcgaatgg
gtcgatgtgcagtgtgagtcgtcgtttgagagactcttacaaaatgtggctgattctgag
ttgaacggggatcatctggtatctgaaggagttgttgagggtgttgtgatcgcttcgcct
tccaagtccgcgccggattatttttaccaatgggttcgtgatgcggccattacgatgcat
acggtagtcaacaatttgttccctgtaacagtggctccctatgatgcgggcgcgggagcg
gtcaatgtgactttggctagaacagtactgaaatacgtgaataattcctatgttttgcaa
agatcagataatccatctggccagggtgtggatggtcaggatgggaaccctttgagaggg
ctgggtgaacccaaatggttggttgataataagccttttacacagaattgggggagaccg
caaaatgatggtcctcctttgagatctcttactattttcactttattacatgaattggcg
cttaatggtgtcgcgctggaagatattattgagaagtgcggctttggcgccgacctgata
tttaggaatgatacagaattatttgaacaaataatatactgggatctaaggttcattatg
tttaattggaaagaggattcgtttgatctgtgggaagaagttaatggaaaacattttttt
acttcattggtgcaatttacttctataaagatggccattagtttcctcgagaagtcagag
aacgaatggacccggtttgataagcaagtgttgctacaggatttgcgtaaatgtctaaat
gatatggctcaattcttgacttttgattcagggtttatcaatcctaataagaattatatc
gtggaaactccatcggtactaaaccaaagatgcggtttagatatcgcagttatcatcgga
tctctattgacacatgccgagaattttgacgtcggtgtaccatttggcgttaccgacacc
ggtgtactaaacactctgtattcgttagtcaaatctatgggggttatctatcctataaac
caccagagggctcctttaaacatcggtgtcgcattaggtagataccctgaagacatttac
gatggtgtgggcacttcggaaggcaacccatggtttctagccacctcggcggctcccgaa
ttgctgtaccgtttgattctcgaaaattacaaattacaaagagatttggtaattcctctg
aaccgttgggaatctgaattttggacactagtgttcgatgggttccaacattacacggac
caggaataccaattagttatcccctggggctcaccagcgtttgggcaaacaatgaccgct
gtattcgatctgggagaatccttcctcgacaagatgcgcgaacatgtaagcgacgcaggc
gagatgagcgaacagtttaacaagtacacaggctatttacaaggagcccacgacctaacg
tggtcctatggagcattatggtcgacttgtcacgcacgcaaacaggtcctaccacttgtt
agcgcttaa

DBGET integrated database retrieval system