KEGG   Torulaspora delbrueckii: TDEL_0D00700Help
Entry
TDEL_0D00700      CDS       T02236                                 

Gene name
TDEL0D00700
Definition
(RefSeq) hypothetical protein
  KO
K01301  N-acetylated-alpha-linked acidic dipeptidase [EC:3.4.17.21]
Organism
tdl  Torulaspora delbrueckii
Brite
KEGG Orthology (KO) [BR:tdl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tdl01002]
    TDEL_0D00700 (TDEL0D00700)
Enzymes [BR:tdl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.21  glutamate carboxypeptidase II
     TDEL_0D00700 (TDEL0D00700)
Peptidases and inhibitors [BR:tdl01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   TDEL_0D00700 (TDEL0D00700)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TFR_dimer Peptidase_M28 PA
Motif
Other DBs
NCBI-GeneID: 11502089
NCBI-ProteinID: XP_003680865
UniProt: G8ZSR0
LinkDB All DBs
Position
4:123998..126361
Genome map
AA seq 787 aa AA seqDB search
MSQGANGESNRESEPLLNGYSSFGSEYLDSRRPSSGLPSIARLRSGTITSIRSTYETVKE
HMDKKKFAYLVLASLFLYLGFVGAFAPRTSLARDLRRIHASRLTDAEVYRIYLNALYSEN
HAGEHLKNYTSQLHGTGDAHVLDYTVSELRKLGFDPKLERYYPWVSEPVDTQVALYVDDT
ITFNATLKEECVAEDPSSCNLIEKRAYHGYSASGNVTSQYIFANYGSLEDYTFLLDNGVD
IDGKVHVIRYGKLLPGLKVKNAELFGASGVLMYTDPYDDGRITKKNGFKMYPAGPARHES
SIERGSVAFMNYFPGDPTTPGYPSKFPGTERLSPAGKVPTIPSIPISAKEIAPILQLLNG
KGVRLGSGGNIDGFEYFSGPSDLNEQVKLYNQQHNSIIEITNVIVEISGIFSEYDILIGN
HRDSWTAGGAGSPNSGSAVLLEIARGMSELLKHGWKPLRPVKLISWDGGELSMLGSSEYV
ENHAEILKRSALVYLNLESAITGSQFSCKSNPLLEDVIRNAAKYTDLGDGDEGTLYDEWK
RATNLTNDHLDGIADYVPFQYHLGIPSASFEFSNNKTCDAVVPYHSIYDTYTWMEKFVDK
DYRHHNTLAVLTGMTSLMLCEREPTVFKVHPYFKDINKWYQKWHQEVLSLFPSDRELRET
AQTVADNLQGVTFNETILFDTQNIELNDLCTRDFATYEFYKKIRIYLQLMRANNKLKQID
QMFLTHRGLLERPWMKHSIYAPDRLTGYDVDVLPGLHEALLDHDRDGVLQWLSILLTQIS
NVKSLLQ
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagggagccaatggagaatcaaatagagagtctgaacctctcttgaatgggtat
tcgtcgtttggcagcgagtatttggactcaagaaggccttcttcgggtctcccctccata
gcgaggttaagaagtggtacaatcaccagtataaggagcacttatgagactgttaaggaa
catatggataagaagaagtttgcctatttagtgctggcgagtcttttcctttatttgggg
tttgtgggagcatttgcacctagaacatcgttggcaagagaccttagacgaattcatgca
tccaggctgacagatgcagaggtttacaggatatatttgaatgcattgtacagcgagaac
catgctggtgaacatctaaaaaattacacgagtcaattacatggtactggcgatgcccat
gtgctagactacacagtatctgaacttcgaaagctgggattcgacccaaaactggaaagg
tactatccgtgggttagtgagccagttgatacgcaagtggctctctatgttgatgacaca
atcacttttaatgcgactttaaaggaagaatgcgtagcagaggatccttccagctgtaat
ctaatcgaaaaacgtgcttatcatggttactctgctagtgggaatgttacatcccagtac
atctttgctaactacggaagtttggaggactacactttcctgctcgacaatggagtcgat
attgacggcaaggttcatgtcatcagatatggtaagctattgcctggcctcaaagtaaaa
aacgccgaactttttggagcttcaggtgtgttaatgtacacggatccatacgatgatggt
cgtataaccaagaaaaatggttttaagatgtatcctgccggtcccgctagacatgagagc
agtatcgaaaggggatctgtcgccttcatgaattattttccaggcgacccaactacacca
ggttatccatcaaaatttccaggcacagagcggctctctcctgcaggaaaggtaccaact
atcccttctattccaattagtgcgaaggaaattgctcctattttacagctgctcaatggt
aagggtgtccgtttaggttctggtggtaacattgatggattcgaatatttcagcggaccg
tctgacttaaatgaacaggttaaactatacaatcagcaacacaattcgatcatcgaaatc
acgaacgtgatcgtggagatctcaggaattttctcagaatatgatatcttaatcggaaac
catcgagactcttggactgcaggtggagcaggaagccctaatagtggcagcgcagttttg
cttgagattgcccgagggatgtcggagctgttaaaacatggttggaaacctttgagacct
gtaaagctgattagttgggatggaggagagttaagcatgctgggctcttctgaatatgtt
gaaaatcacgccgaaatcctcaagaggagtgcacttgtctatctaaacctcgagtcagca
ataactggaagtcaattttcgtgcaagtctaatcccctactcgaagatgtgatacgtaac
gcggccaagtataccgatttgggagacggtgatgagggaacattatatgacgagtggaag
agagctacaaacttaacaaatgatcatctggatggtatagcagattacgtaccattccag
tatcatttgggaataccttctgccagttttgagttcagcaataacaagacctgcgacgca
gtagttccataccattcaatctatgacacctatacttggatggaaaaatttgttgataaa
gattatagacaccataacaccttggcggtcttaactggtatgacttcgttaatgttgtgt
gagagagaaccaactgttttcaaagtacatccctacttcaaagatatcaacaagtggtac
caaaaatggcatcaagaggttttaagtctgttcccaagcgatagagaattacgtgaaact
gctcaaacagtagcagataatttgcaaggcgtaacctttaatgaaacaattctatttgac
acgcaaaacatagagctcaatgatctttgtacgagagatttcgcaacgtacgagttttac
aagaagatccgcatatatctccaattgatgagagctaacaacaaactgaagcagatagat
cagatgtttttaacccacagaggactcctcgaaagaccttggatgaagcactccatctat
gcaccggatagacttacaggctacgacgttgatgttctacctggtcttcacgaagccctt
ctggaccacgatcgcgacggtgtacttcaatggctatcaatccttctgacgcagataagc
aacgttaaatccttacttcaataa

DBGET integrated database retrieval system