KEGG   Torulaspora delbrueckii: TDEL_0E01160Help
Entry
TDEL_0E01160      CDS       T02236                                 

Gene name
TDEL0E01160
Definition
(RefSeq) hypothetical protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
tdl  Torulaspora delbrueckii
Pathway
tdl00020  Citrate cycle (TCA cycle)
tdl00480  Glutathione metabolism
tdl01100  Metabolic pathways
tdl01110  Biosynthesis of secondary metabolites
tdl01130  Biosynthesis of antibiotics
tdl01200  Carbon metabolism
tdl01210  2-Oxocarboxylic acid metabolism
tdl01230  Biosynthesis of amino acids
tdl04146  Peroxisome
Module
tdl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tdl_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:tdl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TDEL_0E01160 (TDEL0E01160)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    TDEL_0E01160 (TDEL0E01160)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    TDEL_0E01160 (TDEL0E01160)
Enzymes [BR:tdl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     TDEL_0E01160 (TDEL0E01160)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh NTP_transf_6
Motif
Other DBs
NCBI-GeneID: 11503760
NCBI-ProteinID: XP_003681570
UniProt: G8ZUR5
LinkDB All DBs
Position
5:234217..235488
Genome map
AA seq 423 aa AA seqDB search
MLGRRFFSSSRSALSKIKVKSPVVELDGDEMTRIIWDKIKTRLILPYVDVDLKYYDLSVT
SRDATQDKITVDAANAIKQYGVGIKCATITPDEARVKEFNLSKMWKSPNGTIRNILGGTV
FREPIVIPRIPRLVPGWEKPIIIGRHAHADQYKATDAIIPGPGKLELVYKPEDGSEPTKL
EVYDYKGAGVALAMYNTDESIRGFAHASFKLALNKKLNLFLSTKNTILKKYDGRFKDIFQ
EIFDAEYKTQFEAANISYEHRLIDDMVAQMIKSKGGFIMALKNYDGDVQSDIVAQGFGSL
GLMTSVLVTPDGKTFESEAAHGTVTRHYRQYQQGKETSTNSIASIFAWTRGLAKRGELDG
TPEVTKFANLLESATLNTVQEDGIMTKDLAFACGKTDRDSYVNTNEFLEAVEKRLKKEIN
SVE
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgttaggaagaagatttttttcgagcagtagatctgctctttcaaagatcaaggtgaag
agccctgttgtagagctagatggtgatgagatgactcgtattatatgggacaaaatcaag
actaggctaattctgccatacgtggacgtcgatctgaagtactatgacttgtcagtaacg
tcacgtgatgcgactcaggataagattacagtggatgctgccaatgctattaagcagtat
ggtgtgggtatcaagtgtgctactattaccccagatgaggcccgtgtcaaggagtttaac
ttgagcaaaatgtggaaatccccaaatggtactattagaaacattcttggtggtactgtc
ttccgtgaaccaattgtgattccaagaattccacgtttagtgcctggatgggagaagcct
atcattattggtagacacgcccatgctgaccagtacaaggcgacagatgcgattattcca
ggtccaggtaaattggaattggtttacaagccagaagatggctctgaaccaaccaaatta
gaagtttacgactacaaaggtgctggtgtggcgttagcaatgtacaacactgatgaatct
atccgcgggtttgcccatgcatcctttaagttggctcttaacaagaaattgaacttattc
ttgtctactaagaacaccatcttgaagaaatatgacggtagattcaaggacattttccaa
gagatcttcgatgccgaatacaagactcaatttgaggcagctaatatttcctacgaacat
cgtttgatcgacgatatggtcgctcaaatgattaaatctaagggtggattcattatggca
ttgaagaactacgatggtgatgttcaatctgatattgttgcacaaggtttcggttctcta
ggtttgatgacctctgtgctagttaccccagacggcaagacttttgagagtgaggcagct
cacggtaccgtcactagacattacagacaatatcaacagggtaaggaaacctcaaccaac
tccattgcttctatcttcgcatggactagaggtctagccaagagaggtgaattggatggt
accccagaagtcactaaattcgccaatttgcttgaatctgctactttaaacactgttcaa
gaggacggtatcatgaccaaagatcttgccttcgcttgcggcaagactgatagagattca
tacgtcaacaccaacgagttcttggaggctgtcgaaaagagattgaagaaagagattaac
tctgtcgaataa

DBGET integrated database retrieval system