KEGG   Torulaspora delbrueckii: TDEL_0E03730Help
Entry
TDEL_0E03730      CDS       T02236                                 

Gene name
TDEL0E03730
Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
tdl  Torulaspora delbrueckii
Pathway
tdl00020  Citrate cycle (TCA cycle)
tdl00190  Oxidative phosphorylation
tdl01100  Metabolic pathways
tdl01110  Biosynthesis of secondary metabolites
tdl01130  Biosynthesis of antibiotics
tdl01200  Carbon metabolism
Module
tdl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tdl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tdl_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:tdl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TDEL_0E03730 (TDEL0E03730)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    TDEL_0E03730 (TDEL0E03730)
Enzymes [BR:tdl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     TDEL_0E03730 (TDEL0E03730)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 11504017
NCBI-ProteinID: XP_003681827
UniProt: G8ZVH2
LinkDB All DBs
Position
5:complement(704085..706007)
Genome map
AA seq 640 aa AA seqDB search
MLSIRNSASAYSRLTLAARRSLHCTSARWQVQGDVQGDANPLQGSKYHVVDHEYDCVVVG
AGGAGLRAAFGLAEAGYKTACISKLFPTRSHTVAAQGGINAALGNMHKDDWQWHMYDTVK
GSDWLGDQDSIHYMTREAPKSIIELEHFGVPFSRTESGRIYQRAFGGQSKEYGKGGQAYR
TCAVADRTGHALLHTLYGQALRHNTHFFIEYFAMDLLTHNGEVVGVIAYNQEDGTIHRFR
AHKTIIATGGYGRTYFSCTSAHTCTGDGNAMVSRAGFPLQDLEFVQFHPSGIYGSGCLIT
EGARGEGGFLVNSEGERFMERYAPTAKDLACRDVVSRAITMEIKEGRGVGKEKDHIYLQL
SHLPPAVLKERLPGISETAAIFAGVDVTKQPIPVLPTVHYNMGGVPTKWNGEALTIDEDG
NDKVIPGLMACGEAACVSVHGANRLGANSLLDLVVFGRAVAHTISDTLQPGLPHKPLPAD
LGKESIANLEKLRTADGSKHTSEIRLNMQKAMQADVSVFRTQQTLDEGVKNMAKIDSTFK
DVKVSDRSMIWNSDLVETLELQNLLTNATQTATSAAARKESRGAHAREDYPERDDENWMK
HTLSWQQSTASPVTLKYRSVIETTLDENECKPIPPAVRAY
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgttgtccatcaggaacagtgcttccgcctattccagacttacattggccgctagaaga
tctctgcactgtacttccgcccgttggcaagttcaaggtgatgtccagggcgatgccaac
cctctacagggctcaaaataccacgttgtggaccacgagtacgattgtgttgttgtaggt
gcaggtggtgcgggtttgagagctgcttttgggctcgcagaagctggttataagaccgct
tgtatttccaagcttttccccaccagatcccacaccgtggctgcccagggtggtattaat
gcagctttgggtaacatgcacaaggatgactggcaatggcatatgtacgataccgtcaag
ggttcggattggcttggagaccaggattctatccactatatgactagagaagcaccaaag
tctattatcgaattggaacatttcggtgtgcctttctcccgtaccgaatcaggcagaatt
taccagagagcattcggtggtcagtccaaggagtacggtaaaggtggtcaggcgtaccgt
acttgtgctgtcgcagacagaacgggccatgcgctattgcatacgctttatgggcaggct
ctaagacacaatacgcatttcttcatcgagtacttcgctatggatcttttgacccataac
ggtgaagtggtgggtgttatcgcgtacaaccaggaagatggtactattcacagattccgt
gctcataagactattattgctaccggtgggtacggtagaacctacttctcctgtacttcc
gcgcatacttgtactggtgacggtaatgcgatggtttcgcgtgcaggtttcccattgcaa
gatcttgaatttgttcaattccatccttctggtatctacggttcaggttgtctgatcacc
gaaggtgctcgtggtgaaggtggattccttgttaatagtgaaggtgaaagattcatggaa
cgttatgctccaacggctaaggatttggcctgtagagatgtcgtgtcacgtgccattacc
atggagatcaaagaaggccgtggtgtaggtaaggagaaggaccatatctatttgcaacta
tctcatttgcctccagctgtcttgaaggaacgtttgcctggtatctctgagacggctgcc
attttcgcaggtgtagatgttacaaaacaacctattccagtgctaccaactgtccactac
aatatgggtggtgttccaactaaatggaacggtgaagcattgactatcgatgaagatggt
aatgataaagttattccaggtttgatggcttgtggtgaagctgcatgtgtttccgtgcat
ggtgccaacagattgggtgctaactctttgctggatttggtcgtctttggtcgtgctgtg
gctcataccatctctgataccctgcagccaggtttaccacataaaccattgcctgctgac
ttgggtaaggagtctatcgctaacttggagaaactaagaaccgccgatggttcaaaacat
acttctgagatcagattgaacatgcaaaaagctatgcaagcagatgtttctgttttcaga
actcagcagactctagatgaaggtgtcaagaacatggctaagattgattccactttcaag
gatgttaaggtctcagatagatccatgatttggaactctgatttggttgaaactttagaa
ttacaaaacttgttgacaaacgctacacaaaccgctacttctgccgcagcaagaaaggaa
tctcgtggtgctcatgcaagagaagattacccagagagagatgacgaaaactggatgaag
cacactctatcatggcaacaatccacagcaagtcctgttactttgaaatacagaagtgtc
atcgaaactacattggacgaaaacgaatgtaaaccaattccacctgcagtgagagcttac
tag

DBGET integrated database retrieval system