KEGG   Torulaspora delbrueckii: TDEL_0E05220Help
Entry
TDEL_0E05220      CDS       T02236                                 

Gene name
TDEL0E05220
Definition
(RefSeq) hypothetical protein
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
tdl  Torulaspora delbrueckii
Pathway
tdl04113  Meiosis - yeast
tdl04138  Autophagy - yeast
tdl04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:tdl00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    TDEL_0E05220 (TDEL0E05220)
  09143 Cell growth and death
   04113 Meiosis - yeast
    TDEL_0E05220 (TDEL0E05220)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    TDEL_0E05220 (TDEL0E05220)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tdl01001]
    TDEL_0E05220 (TDEL0E05220)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:tdl03019]
    TDEL_0E05220 (TDEL0E05220)
   03036 Chromosome and associated proteins [BR:tdl03036]
    TDEL_0E05220 (TDEL0E05220)
Enzymes [BR:tdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     TDEL_0E05220 (TDEL0E05220)
Protein kinases [BR:tdl01001]
 Serine/threonine kinases: AGC group
  PKA family
   TDEL_0E05220 (TDEL0E05220)
Messenger RNA biogenesis [BR:tdl03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     TDEL_0E05220 (TDEL0E05220)
Chromosome and associated proteins [BR:tdl03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    TDEL_0E05220 (TDEL0E05220)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo Seadorna_VP7 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 11500886
NCBI-ProteinID: XP_003681976
UniProt: G8ZVX1
LinkDB All DBs
Position
5:complement(957515..958597)
Genome map
AA seq 360 aa AA seqDB search
MDIGYQQPQHHQPQHHQVPQQYYANYESREKSLLPQKSVVSKGKYSLQDFQIMRTLGTGS
FGRVHLVRSVHNGRYYAMKVLKKQQVIKMKQIEHTNDERRMLKLVEHPFVIRMWGTFQDA
RNLFMVVDYIEGGELFSLLRKSHRFPNPVAKFYAAEVTLALEYMHSHNIIYRDLKPENIL
LDRNGHIKITDFGFAKEVVTVTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIFEMLA
GYTPFYDNTPMKTYEKILQGKVNYPPFFHPDAVNLLSNLITADLTRRLGNLQSGSDDIKS
HPWFSEVVWEKLLAKDIETPYEPPIQAGTGDTSLFDQYPEEHLDYGIKGEDPYAQYFVDF
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggatattggataccagcagccacagcaccaccagccacagcaccaccaagtgcctcag
cagtactatgctaactatgaatctcgagagaagtctttgttgccccagaaatctgttgtg
tcgaaggggaaatactcgttacaggatttccagattatgaggaccctggggactggctcg
tttgggcgtgtacacctggtaaggtctgtgcacaacggtcgttattatgcaatgaaagta
ctgaagaagcagcaagtgattaagatgaagcagattgagcatacgaatgatgagcgtagg
atgttgaaactcgtggaacacccatttgttatccgtatgtgggggactttccaggatgcc
cgtaatttgttcatggtggtcgactatattgaaggtggtgaattgttctcactattgcgt
aagtctcatcgtttcccaaatcccgtggccaagttctacgcggcggaagtaactctggca
ttggaatacatgcattcccataacattatctatcgtgatttgaaaccagagaatatcttg
ctggatcgtaatggacatatcaagatcactgattttggatttgccaaagaagttgtcact
gtgacttggactttatgcgggactccggattatatcgcaccggaagtgatcactacaaaa
ccttataacaaatctgtcgattggtggtctctcggagtgctaatctttgaaatgctcgca
ggttacacacctttttacgataacacaccgatgaagacttacgagaagattttgcaaggt
aaagttaactatcctcctttcttccacccagatgcagtgaacttattgagcaaccttatc
acagcagacttgactagaagactaggtaatttacaaagcggatcagacgatattaagtcg
catccatggttcagtgaagtggtgtgggaaaagttactcgccaaggatatcgagacgcca
tacgagccaccgatccaggccggtacaggtgacacttcgctctttgaccagtacccagag
gagcacttggactatggtatcaaaggcgaggacccttatgcacagtattttgtggatttt
tga

DBGET integrated database retrieval system