KEGG   Torulaspora delbrueckii: TDEL_0F03900Help
Entry
TDEL_0F03900      CDS       T02236                                 

Gene name
TDEL0F03900
Definition
(RefSeq) hypothetical protein
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
tdl  Torulaspora delbrueckii
Pathway
tdl00220  Arginine biosynthesis
tdl00250  Alanine, aspartate and glutamate metabolism
tdl01100  Metabolic pathways
tdl01200  Carbon metabolism
tdl01210  2-Oxocarboxylic acid metabolism
tdl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tdl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TDEL_0F03900 (TDEL0F03900)
   00220 Arginine biosynthesis
    TDEL_0F03900 (TDEL0F03900)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tdl01007]
    TDEL_0F03900 (TDEL0F03900)
Enzymes [BR:tdl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     TDEL_0F03900 (TDEL0F03900)
Amino acid related enzymes [BR:tdl01007]
 Aminotransferase (transaminase)
  Class I
   TDEL_0F03900 (TDEL0F03900)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 11501796
NCBI-ProteinID: XP_003682412
UniProt: G8ZX57
LinkDB All DBs
Position
6:complement(726159..727838)
Genome map
AA seq 559 aa AA seqDB search
MSSIAVTQRCYMRSTSVGLISRASAMPHTITTTLQGRSGLGRSYMNIKRARSTSSTAAGL
HHIYHKKCHQDFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDK
IVNANIGNPQQLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRD
VGGSVGAYSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQ
ETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVL
VVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQK
EHPGIYDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQ
ALVDLMVCPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLF
PQIKLPYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGT
EWIKKWEDFHKKFYDQYRD
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccattgcagtgacccaacgttgttacatgcggtctacctccgttggactaatt
tctagagcttctgctatgccacataccattacgaccaccctgcaaggtcgcagcggcctt
ggtcgttcctatatgaatattaaacgggctagatccactagttccactgctgctgggttg
catcatatttaccataaaaaatgccatcaggatttctatccagcagagagtttaactgtg
cgagacttgaatgagaacgtgttgaaggctaaatatgccgtcagagggtccattcctatg
agagcagaagaactacaggaacaattgaaacgtgatccatcgagtctgccttttgataag
attgtcaatgctaacatcggtaatccacagcagttaaatcagaaaccactgagtttttac
agacaggtgctgtcgatacttcagtatccagaagttcttgagcaaggtgaagaagaattg
atttctaagggcgttttcaagagggatgccattgaacgtgctaagaggattttgagagac
gttggagggtctgttggggcttactctagttcccagggtgtctatggaattagaaagaca
gtcgctgattttattacagaaagagacagtggggaaccagcttacccagaagatatcttc
ttgactgcaggtgcttctgcagctgtctcgtatttgttatccattctttgtagaggtcaa
gagacgggtgtactgattccaatcccacaatatccgctttacactgctactctagcactt
aacaactcgcatgtactaccttactatttggatgaagagtctggttggtccactaatacc
gcagagattgaaggtgttgtaaccgaatccatcgaaagtggaattcgcccatcggtgctt
gtcgtgataaaccctggtaatccaaccggttcggtgctttctgttgaagccatagagaag
atattccaagttgctgccaaatacggtatcgtggtgattgcagatgaagtttaccaggag
aatatctttgctggatctgagttccattccatgaaaaaggtcctgagacaattacaaaag
gaacatcctggtatttacgataacgttcaattggtatcgctgcattccacctccaagggt
gtttccggtgagtgtggtcaaagaggtggttacatggaactaacaggtttcacgcatgaa
attagacaagtggtattgaaattggcttccatctcgctatgtccagtggtcactggccaa
gctttggtagatctaatggtatgtcctccaaaaccgggcgatgagtcttacgaacaagac
aggaaggagcgcgagatgattcacgaagaattggatcatagagctggtctgttgcatgat
actttcaactcattggagggtatcgaatgtcaaaaaccaagaggtgctatgtacctcttc
ccacaaatcaaattgccttataaagcaattcaagccgctcagcatttagaaaagactccg
gacgagttttactgtcaaaagctattggaagctacgggtatttgcacggttccaggttct
ggttttggtcaagaaccaggtacttaccacttgagaaccactttcttggctccaggaact
gaatggattaagaaatgggaggatttccataagaaattctacgaccagtatcgtgactga

DBGET integrated database retrieval system