KEGG   Torulaspora delbrueckii: TDEL_0F04380Help
Entry
TDEL_0F04380      CDS       T02236                                 

Gene name
TDEL0F04380
Definition
(RefSeq) hypothetical protein
  KO
K12158  ubiquitin-like protein Nedd8
Organism
tdl  Torulaspora delbrueckii
Brite
KEGG Orthology (KO) [BR:tdl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:tdl04121]
    TDEL_0F04380 (TDEL0F04380)
Ubiquitin system [BR:tdl04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   TDEL_0F04380 (TDEL0F04380)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 YukD TBK1_ULD Rad60-SLD_2
Motif
Other DBs
NCBI-GeneID: 11501844
NCBI-ProteinID: XP_003682460
UniProt: G8ZXA5
LinkDB All DBs
Position
6:complement(join(823866..823950,824011..824159))
Genome map
AA seq 77 aa AA seqDB search
MIIKVKTLTGKEIAVELKSDAPIYRIKQLLEEKEGIPPSQQRLIFQGKQIDDRQTLEAAK
LVDGMVLHLVLTLRGGC
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcaaggtcaagacgctgactggtaaagagattgcagtggaactgaagagtgat
gctccgatatatcgtatcaaacagctgttagaagagaaagagggtatccccccatctcaa
caacggcttatatttcaaggtaaacagattgacgaccgacagaccctggaggccgccaag
ctcgtcgatggtatggttctgcatctcgtgctgacgttgagaggaggatgttga

DBGET integrated database retrieval system