KEGG   Torulaspora delbrueckii: TDEL_0F04390Help
Entry
TDEL_0F04390      CDS       T02236                                 

Gene name
TDEL0F04390
Definition
(RefSeq) hypothetical protein
  KO
K19589  release factor glutamine methyltransferase [EC:2.1.1.297]
Organism
tdl  Torulaspora delbrueckii
Brite
KEGG Orthology (KO) [BR:tdl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:tdl03012]
    TDEL_0F04390 (TDEL0F04390)
Enzymes [BR:tdl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.297  peptide chain release factor N5-glutamine methyltransferase
     TDEL_0F04390 (TDEL0F04390)
Translation factors [BR:tdl03012]
 Eukaryotic Type
  Release factors
   TDEL_0F04390 (TDEL0F04390)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS Methyltransf_23 Methyltransf_25 PrmA Methyltransf_31 Methyltransf_33
Motif
Other DBs
NCBI-GeneID: 11501845
NCBI-ProteinID: XP_003682461
UniProt: G8ZXA6
LinkDB All DBs
Position
6:824317..824994
Genome map
AA seq 225 aa AA seqDB search
MLPTPYVRCDYDTVYEPSEDSFLLLDALEEERASLGATFQDKLSIVCELGPGSGIITTFM
MQNGIPTKDKSIYLAADISPWALEATRDTAKHNSCNGTYLEPLQSDLASCLKGREVDLLV
FNPPYVPAEHVPEAPRMGEDHRMWLDLALLGGEDGMAVTKRLLDQLDNILSKKGVAYILF
CARNRPEEVAQRMRHNGKWKVDLIMHRKAGWEVLSVYRFCRDNAI
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgcttcctacaccatacgttcgatgcgattatgatacggtttatgagccctcagaagat
agcttcctgctcttggatgctttggaggaagaaagagcaagtttaggtgccacatttcag
gataagttgtcaattgtctgcgaattgggcccaggctcaggtataatcactacgtttatg
atgcaaaatggaatcccaacgaaggacaaatccatctatttggcggcggatatcagtcct
tgggcactcgaggcaactagagatactgctaagcataatagctgcaacgggacttacttg
gaaccattacagagcgatttggcttcctgcttaaagggtcgagaagttgacttgttagtc
ttcaatcctccctatgttccagcagagcacgttccagaagctcctaggatgggagaagat
caccgtatgtggcttgatctggcgctgctaggtggcgaagacggtatggctgttactaaa
agattacttgatcagctcgataacatactctcaaagaaaggggtcgcatacatcctattt
tgtgcccgaaataggcctgaagaagtggcccaaaggatgagacataatggaaagtggaaa
gttgacctgataatgcacaggaaggcaggttgggaggtcttgagcgtctacaggttctgt
agagacaatgcaatctaa

DBGET integrated database retrieval system