KEGG   Torulaspora delbrueckii: TDEL_0F04400Help
Entry
TDEL_0F04400      CDS       T02236                                 

Gene name
TDEL0F04400
Definition
(RefSeq) hypothetical protein
Organism
tdl  Torulaspora delbrueckii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dopey_N
Motif
Other DBs
NCBI-GeneID: 11501846
NCBI-ProteinID: XP_003682462
UniProt: G8ZXA7
LinkDB All DBs
Position
6:complement(825031..830097)
Genome map
AA seq 1688 aa AA seqDB search
MSLPLKPLTIDSNSKQLDSKQKKFNANVLRALEHFDLVTEWADYIASLGKLLKALQSWSP
QFQNVRYYVPSPYQVSRTLTSSLSPNLPAGVHQKTLEVYTFIFEKIGQDILASECNIWIP
GILPLMTYASMSVKSHLIDLYDNYLVQLPSSTLKLLVRPMLASLLPGIDDESSEFQPLSI
KLIESLQENLADDSLFWQTCFLVMISNKERRLGGLVWLTKKFPSMNSVPHLLSQKNKEPK
NDSKADGEPLDAKALRNEALSLLLPETKILLTPDPGLLVRCLACCLDDGNDLLIQRGIWD
LLLQRLHLDSPVLDALVSPADKQLLIMSCCRTTLAKDMSLNRRVWNWLVGPAVAAQANTN
NSVSPTVQKNDRSNQSNSEYFSIHGLQSLKAGLNSMLELESQVTTAFSICSAVMDRWEIG
SLVVPEMFIPLLVAAHKHQYNERIIKAANSFFDSVETNIIWGKLFQSIEKHEDLPLVEFV
LANFNIASDEEIIVRHLPLILLAILSIDCQNPDCSPSSKDERYLLCRHLLEKTPERAFVP
LESSEIRTNDEHNSEVLEKISKFYCRVSDPATSQNAEKSSNQTAPFDSHVLSLQIFSHAY
KLLIQSLKHDTHVNSVVAIFMMIINKIPKAEDGMSAKAAKQEDNELADLLFERCLEVPEG
FTDSVFGMVDVFSSYLCPKLPLMQSCKLLQHLLEALWSLLAEPKKQLRAIKSLQTLENCA
CSTYLEGALSHVFIKEKDISKCLKVLELLWNHLDPRTKILSRPLELMIDELFAEENPHYL
NVSKWILSAVNSGTSNRLFYFLTDKVLQMDFLRRETLEEWDDLDMFTYRLRSLTSVLKTN
NGVVIQNFASELTSISSLIMWGDADISTYKNLMIAILMKFLEIKNNNHAKSVRSALILLE
CILNGTERNFKEIVIVLLQMSSKYIAQGGLDSELIAVSLLNIVSKVLRLSHENGIKLDIF
DDDTTHLKYVDYLVTSVATMESPLIVTSYMKLLSESMMYFETAMFRMILPLSASIVQCVR
RLFMKEKEDGGYYQSVSLLLNGLEQLLEVSHGFLTAEEKDGYFATSGSKGDFLQAVVSNV
FSSDTSGNDVKIQGERDVVLQSFREVISCCHDIWSWAHALSISTKDGYLANHTNHSSYKF
KFTTKKILEKLFVLEPLEVMESLVLSLGGETLILIHVLDGNRPALTLPYFSLGVVYRQNR
NSSIRFSISLSANSTSSARAGRLEASLSNKLDSESLMRFLISYASSLENAAIEDFYNDFL
QFFKEISANYNLYENISKSVLNFVAIIAKKLNRSKFGEDKRTRRELSDTFMRYLPNALAE
NPFNYADPSTAFSDLQYVVKDIQDILNEEVGSDKFNNAVSVIVSQCVSPYFKAKNVAIPE
YVLALAVEIAKVGSKVRNWRTLINDFYFDNKKFSLLADNKLWDQIIFQWSRYPDNKTKLM
NDMLAVIGPKMTSITPALITFNSRNDSEIEAKCQNLLRIAHLLMISPSDFHMLYFQPLIS
CTCQFLLSAELTLKEKAWILLRAMLLKFEEQHFIEYWSMITYCLQTNLQEFCETLQIQGD
IHSGAVFQACKTLDLLLALNLEGFSSTNEWLFVIDTINCIYKNYPFVALIDEIYECKEFE
SSKMDELELVDRSQLKVPILKGIHAIRSYTQLRVFFQNLSYAHYEYIYGLERLDLDDCEN
DLKVDIFT
NT seq 5067 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgcctctcaaacctctgactattgactcgaacagcaagcaattggactcgaaa
cagaagaaattcaacgctaatgttctacgagcattggagcactttgacttggtcacagaa
tgggcagattatattgccagcctgggaaaactattgaaggctttacaaagctggtctcca
cagtttcagaacgtaaggtactatgttccttcgccgtatcaggtaagccgaacattgact
tcgtctctatcaccaaatttgccggctggtgtccaccaaaagacattggaagtatataca
ttcatctttgagaagattggacaagacatattggcgtcagaatgtaacatatggattccc
ggcatattacctttaatgacatacgcatcaatgtcagtcaagtcacacttgattgatctt
tatgacaattacctagttcaattgccctcttctaccctcaaactgttggtaagacccatg
ttagcaagcctgctgcctggtatcgacgatgaaagcagtgaattccagcctttatccatc
aaactgattgagtccctgcaagagaatttagctgatgactccttattttggcagacgtgc
ttcttggtaatgatttcgaacaaagaaagacgattaggtgggttagtatggttgaccaag
aaattcccatccatgaactcagtaccacatttgctttcacagaagaacaaagaaccgaag
aatgattcaaaagcggacggagaaccattggatgcaaaagcactaagaaacgaggctctt
tcattacttcttccagagacaaagatcttgcttacgccagatccaggtctgctagttcgt
tgcttagcttgttgtttggatgatgggaacgatcttttaatacaaagaggtatctgggat
ttgcttctacagaggctacatcttgattcaccagtactagatgctctagtgagtccggct
gataagcagttactcataatgagctgttgcaggacaacgttggcgaaagacatgtcactg
aatagaagggtctggaattggctagtcggtcccgcagtggcggcacaggctaacacaaac
aatagtgttagtccaactgtacaaaagaatgacaggtcgaatcaaagcaatagtgagtat
tttagtatacatggtttacaatcactaaaagcgggtctgaatagtatgttggaattggag
tcccaagtaacaaccgctttcagtatatgctcagctgttatggatcgatgggagattgga
tccttggttgttcctgaaatgttcatacctttgcttgtggcagcacataagcatcaatac
aatgaacggataatcaaagctgccaactcattctttgattctgttgagacaaacataatt
tggggaaagttgtttcaatccattgagaaacatgaggacctgccactagttgagtttgtt
ctggcgaactttaatattgcatcagatgaagagataattgttcgtcatctcccgcttatt
ctactagctatcttgtccattgattgtcaaaaccccgattgttctccatctagtaaagat
gagagatatcttttgtgcaggcacttactcgaaaaaacaccagagcgtgcattcgttcct
ttggaaagctcagaaataagaacaaacgatgagcacaattctgaagtgcttgagaaaatc
tcaaagttttactgtcgcgtttcggatcctgccacatcccaaaacgctgagaagagttca
aatcaaacagctcctttcgactcacatgtactttcccttcaaatttttagtcatgcttac
aagctactaatacaaagcttaaaacatgatacgcacgtcaattcagtagtcgcaattttt
atgatgataatcaataagatccctaaagctgaagatggtatgtcggctaaggcagcaaaa
caagaagacaatgagttggctgatctactatttgaacgctgtttggaagttcctgaagga
ttcactgactctgtgtttggaatggtcgatgtttttagtagctacctgtgccctaagcta
ccactaatgcagtcgtgtaaattattgcagcatcttttagaagctctgtggagccttttg
gcagaaccaaaaaaacaactaagggccatcaagagcttacaaacactagaaaactgtgca
tgttccacatatcttgagggtgccctctctcatgtttttattaaggagaaagacatctcg
aagtgtctcaaagtactggagctcttatggaaccatttggacccccgcactaagattctt
tcacggccattagaacttatgatagacgaactatttgcagaagagaatccgcattatctg
aatgtttcaaaatggatcctatcagcagtaaactctgggacctctaataggcttttctat
tttctaactgacaaggtgttgcagatggatttcttgagaagggagacacttgaagaatgg
gatgacctggatatgttcacgtacagacttcgatcacttaccagcgttttgaagaccaac
aatggagttgtaattcaaaactttgcgtcggaattgacctctatctcttcattgataatg
tggggagacgctgatatatcaacatacaagaacctcatgattgcaattttgatgaaattc
ttggaaatcaagaataataatcacgccaaaagtgtacgaagtgctctgattcttttagaa
tgtattctcaatggtaccgagcgcaatttcaaggagattgtgattgttctgcttcaaatg
tcatcgaagtacatagctcagggtgggctggactctgaacttattgcggtttctttgctc
aacatagtctccaaagtgttaagactatctcatgagaacggaatcaagctggacattttt
gatgacgacaccacacatcttaaatacgtcgactacctggttaccagtgttgcgacgatg
gaaagcccattgattgtgacatcatatatgaagctcttgtctgaaagtatgatgtacttc
gaaactgccatgttcaggatgatccttccattaagtgcatcaattgttcaatgtgttaga
agactcttcatgaaggaaaaagaagatggaggatactatcagtccgtttctctcctcctg
aatggtctggaacagttgttggaggtatctcacggattcttaaccgctgaagagaaggac
ggctactttgctacctctggatcaaagggtgactttcttcaggcagtggtttccaatgtg
ttttcatcagacacatctggcaatgacgttaagatccaaggagaaagggatgtcgttctt
cagtctttccgggaggtcataagttgctgtcatgacatatggtcgtgggctcatgcactt
tcaatatctacaaaagatggctacctcgcgaaccataccaatcacagttcttacaagttc
aaatttacgaccaaaaaaatacttgagaaactctttgttctcgaaccattagaggttatg
gagtcattggtattgagccttgggggagagacattgatcctgattcacgtattagatggg
aacagaccggctcttacgctgccttatttttccttaggtgtcgtatacaggcaaaatagg
aactccagtattagattctccataagtttgtcggcaaacagtactagcagcgccagagcg
gggcgcttggaggcgtcattgagtaacaaacttgactcagagagtctaatgagatttcta
attagctacgcctcttcacttgagaatgctgccattgaggacttttacaacgattttctg
caatttttcaaggaaatttctgctaactacaacctttacgagaatatctcgaaatctgtt
cttaacttcgtggctattattgcaaagaaactcaataggtccaaattcggtgaagataaa
aggactagaagggaactgtcagatactttcatgagatatctacctaacgcattggctgag
aaccctttcaactacgctgatccatcgacagctttttctgatctccaatatgttgttaag
gatatacaggatattttgaatgaggaggtgggaagcgacaaatttaacaacgccgtttca
gtaatagtttcacagtgcgtctctccatatttcaaggccaaaaatgttgccattccagaa
tatgtattggcgttagcggtggagattgcgaaggttggtagtaaagtaagaaattggcgt
acccttatcaatgacttctattttgacaataaaaaattctccttgcttgccgataataag
ctatgggaccagataatattccaatggtcgcgctatcctgacaataagacaaaactgatg
aatgatatgttagcagtgataggccccaaaatgaccagtatcactccagcactaatcact
ttcaactccaggaatgattctgagattgaggcaaagtgccaaaatctcttgaggattgca
catttattaatgatctctccttcagactttcatatgctatattttcagccactaatttcg
tgtacctgccaattcctcctttcagcagaattgacgttgaaagagaaagcatggatcctt
ttgagggccatgctactgaagtttgaagaacaacatttcattgagtactggtcaatgata
acatactgcttgcagacaaacttgcaagagttctgcgaaactctacagattcagggtgat
atacattcaggagctgttttccaagcatgtaagacgcttgatcttcttttggctttgaac
ctcgaaggcttcagcagcacaaacgaatggctctttgtcatcgacaccattaattgcatt
tacaaaaattatccattcgttgcattaattgacgagatatacgaatgcaaagaatttgag
agcagcaagatggacgagctcgagcttgtcgatcgctctcagctgaaggtacccattctc
aagggaattcacgctattcgcagctatacacaactgcgagtttttttccaaaacttgagc
tatgctcactatgagtatatatacggactcgaaaggctagacttggatgactgcgaaaac
gacttgaaagttgacatttttacatga

DBGET integrated database retrieval system