KEGG   Torulaspora delbrueckii: TDEL_0F04430Help
Entry
TDEL_0F04430      CDS       T02236                                 

Gene name
TDEL0F04430
Definition
(RefSeq) hypothetical protein
  KO
K13341  peroxin-7
Organism
tdl  Torulaspora delbrueckii
Pathway
tdl04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:tdl00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    TDEL_0F04430 (TDEL0F04430)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40
Motif
Other DBs
NCBI-GeneID: 11501849
NCBI-ProteinID: XP_003682465
UniProt: G8ZXB0
LinkDB All DBs
Position
6:complement(831678..832781)
Genome map
AA seq 367 aa AA seqDB search
MLGYHIPGYSGYGVQYSPFFDNRLAVVSGSNFGLVGNGKLFILDIDPQGKIHESNSFLTQ
DCLFDVAWNELHENQVLVAQGDGSLRLFDTKLAQYPIAIFKEHQKEVFSCNWNLLNKNTF
VSSSWDGTVKIWSPTRKDSLLTLTPQPLKTVNRVDHSMNIPMSNQRNHADITRNKNCIYQ
AQFSPHDPNLVMCCSGNSYITIFDLRQPPSPTNQRNFLGHSGLEALTCDFNKYRPHTIAT
GGVDNVIRIWDLRMTSKNNSSPSICVNEVVGGHELAVRKVCWSPHHSNIFLSTSYDMTCC
VWQDVSYTDRRSTGKTNSIDPNRGCRFKFTQHSEFVYGADWSLWGQPGYIASTAWDGNVF
IWNAFQR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgctaggatatcacatccctggctatagcggctacggcgtacaatactccccattcttt
gataacagattggcagtggtctctggctcgaattttgggttggtagggaacgggaagctt
tttattttagatatcgatccacaggggaagattcacgaatcaaactctttcctgacccaa
gattgcctctttgatgttgcgtggaatgaactacatgagaatcaagtacttgttgcccag
ggagatggatctctacgattatttgatacaaaactggctcaatatccaatagctatcttc
aaagaacatcaaaaggaggtcttcagttgcaactggaaccttttaaacaagaatacattt
gtcagtagttcctgggatggtacagttaaaatatggtctccaacaaggaaggacagttta
ttgacgcttacaccacaacctttgaagacagtgaatcgagtagatcacagtatgaacata
ccgatgtccaaccagagaaaccatgcagacatcaccagaaataagaattgcatttatcag
gctcaattttcacctcatgaccccaatttagtgatgtgttgctctgggaactcttatata
actatattcgatttgagacaaccaccatcgccgacaaatcaaagaaactttttgggtcac
tcaggattagaagcactgacatgcgatttcaacaaatataggccacatacgattgccact
ggtggcgtggacaatgttattcgtatctgggatctgaggatgacgagcaaaaacaactct
tctccatccatttgcgttaacgaggttgtcggcgggcatgaactggcagtcagaaaagtt
tgctggtctccacaccattctaatattttcctctcaacatcttacgatatgacttgctgc
gtatggcaggacgtcagttatactgatagacgcagcacagggaaaacaaacagcatagat
cccaatcggggttgtcgatttaagtttacccaacattcagagtttgtttatggtgcggat
tggagtttgtggggccaaccaggttacattgcatcgacagcatgggatggtaacgttttc
atctggaatgctttccaaagatga

DBGET integrated database retrieval system