KEGG   Torulaspora delbrueckii: TDEL_0G01780Help
Entry
TDEL_0G01780      CDS       T02236                                 

Gene name
TDEL0G01780
Definition
(RefSeq) hypothetical protein
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
tdl  Torulaspora delbrueckii
Pathway
tdl00020  Citrate cycle (TCA cycle)
tdl00190  Oxidative phosphorylation
tdl01100  Metabolic pathways
tdl01110  Biosynthesis of secondary metabolites
tdl01130  Biosynthesis of antibiotics
tdl01200  Carbon metabolism
Module
tdl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tdl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tdl_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:tdl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TDEL_0G01780 (TDEL0G01780)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    TDEL_0G01780 (TDEL0G01780)
Enzymes [BR:tdl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     TDEL_0G01780 (TDEL0G01780)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_7 Fer4_9
Motif
Other DBs
NCBI-GeneID: 11504682
NCBI-ProteinID: XP_003682756
UniProt: G8ZYS0
LinkDB All DBs
Position
7:359841..360623
Genome map
AA seq 260 aa AA seqDB search
MNGLVKQRVAGGILRRGLATASQTPRLKTFKIYRWNPDKPAEKPRLQSFQVDLDDCGPMV
LDALLKIKDQQDSSLTLRRSCREGICGSCAMNIGGRNTLACLCKIDQDHKKETKIYPLPH
MYIIKDLVPDLTNFYQQYKSIQPYLQRSTFPADGKEVLQSVADRKKLDGLYECILCACCS
TACPSYWWNQEQYLGPAVLMQAYRWLVDSRDQAGAIRKNMLQNSMSLYRCHTIMNCTRTC
PKGLNPGLAIAEIKKAIATD
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaatggattagtgaagcaaagagtcgcgggaggaatattgagaagaggtctggccacc
gcttctcagactcctagattgaagacattcaagatttacagatggaatcctgacaaacca
gctgaaaagccacgtttgcaaagtttccaggtggatttggatgactgtggtcccatggtg
ctagatgcacttttgaagattaaggatcaacaggattcgtctttgactttgagaagatca
tgtagagaggggatttgcgggtcttgtgcgatgaacattggtggtagaaacactttggct
tgtctgtgtaagattgatcaggaccataagaaggagactaagatttatccgctacctcat
atgtatatcatcaaggatttggtgcccgatttgacaaatttctaccaacagtacaagtcg
attcagccatatttgcagaggtctactttcccagcggatggtaaggaagtcttgcagagt
gttgcggaccgtaagaaattggatgggttgtacgaatgtatcttgtgtgcttgttgctcc
actgcttgtccttcttactggtggaaccaggaacaatacttgggtccagctgtgttgatg
caagcttaccgttggttagttgattcaagagaccaggctggtgccattagaaagaacatg
ttgcaaaactctatgtccttgtacagatgtcacaccattatgaactgtactagaacttgt
cctaaaggtttgaaccctggtctagcaattgcagagatcaagaaggctatagccaccgat
tga

DBGET integrated database retrieval system