KEGG   Torulaspora delbrueckii: TDEL_0G03220
Entry
TDEL_0G03220      CDS       T02236                                 

Gene name
TDEL0G03220
Definition
(RefSeq) hypothetical protein
  KO
K12766  serine/threonine-protein kinase MDS1/RIM11 [EC:2.7.11.1]
Organism
tdl  Torulaspora delbrueckii
Pathway
tdl04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:tdl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    TDEL_0G03220 (TDEL0G03220)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tdl01001]
    TDEL_0G03220 (TDEL0G03220)
Enzymes [BR:tdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     TDEL_0G03220 (TDEL0G03220)
Protein kinases [BR:tdl01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   TDEL_0G03220 (TDEL0G03220)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Choline_kinase APH Pkinase_fungal Kdo Seadorna_VP7
Other DBs
NCBI-GeneID: 11504984
NCBI-ProteinID: XP_003682900
UniProt: G8ZXS2
LinkDB
Position
7:complement(600259..601350)
AA seq 363 aa
MMNVEITNEAVVHKQVYVGHASGDSGPIEISYPTTEVVGHGSFGVVFTTTIEQTGEMVAI
KKVLQDRRFKNRELEIMKLLQHRNVIDLKYYFYEKDPHGDVYLNLILDFMPQSLYQRLRH
FVHLSSVMPRLEIKCYMYQLFKALNYLHHHANVCHRDIKPQNLLVDPQSWELKLCDFGSA
KQLKPAEPNVSYICSRYYRAPELIFGATNYLNQIDVWSSGCVMAELLLGQPMFPGESGID
QLVEIIKILGTPSKQEICAMNPNYMEHKFPQIKPIPLSKVFKKEDEPTVKFLTNTLKYDP
LERFNSLQCLCATYFDEIRFATEDFKRIVDNLQLLKFDYETELGHLTQDQLAAVKLKLTP
NII
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgatgaacgttgagattactaacgaagcagtagtgcacaagcaggtatatgtgggtcat
gccagtggtgattctgggccgattgagatttcgtacccaaccacagaagtggtcgggcat
ggatcttttggagtggttttcacaactaccatcgagcagacgggagaaatggtagcgata
aagaaagtcctacaggatcggagattcaagaatcgagagttggaaatcatgaagttgttg
caacatcgtaacgtgatagatttgaagtattatttttatgaaaaggaccctcatggcgat
gtgtatttgaatctaatacttgattttatgccacagtcgttgtaccagaggctacgtcat
tttgtgcatttgagtagtgttatgccccggctggagatcaaatgctacatgtatcaactt
ttcaaagcacttaattatttgcatcatcacgccaatgtgtgtcatagggatatcaagccg
cagaatttgttggttgatccacagagttgggagttaaaactgtgtgatttcggtagtgcg
aaacagttgaaaccagctgagcccaacgtgtcgtatatttgctcgcgttattaccgggcg
ccagaactgatctttggtgcaacgaattatctcaaccagatcgacgtgtggtccagtggg
tgtgttatggctgaattactactggggcagccgatgttcccaggtgaaagcggaatcgat
cagcttgtggaaattatcaagattcttgggacaccttcaaaacaggaaatttgcgccatg
aatccaaactatatggagcataagttcccgcagattaaaccaatcccattatcaaaagtc
ttcaagaaagaagatgaaccaacggtgaaatttctgacgaatacgttgaaatatgatcca
ctagagagatttaactctttacaatgtctctgtgcgacgtatttcgatgagattaggttc
gctacagaagacttcaaaagaattgtagataacttacaattgctaaaatttgattacgag
accgagttggggcatttgactcaggatcaattagctgctgtaaaattaaaattgacgcca
aatataatatga

DBGET integrated database retrieval system