KEGG   Torulaspora delbrueckii: TDEL_0H02010Help
Entry
TDEL_0H02010      CDS       T02236                                 

Gene name
TDEL0H02010
Definition
(RefSeq) hypothetical protein
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
tdl  Torulaspora delbrueckii
Pathway
tdl00061  Fatty acid biosynthesis
tdl00780  Biotin metabolism
tdl01100  Metabolic pathways
tdl01212  Fatty acid metabolism
Module
tdl_M00083  Fatty acid biosynthesis, elongation
tdl_M00874  Fatty acid biosynthesis in mitochondria, fungi
Brite
KEGG Orthology (KO) [BR:tdl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    TDEL_0H02010 (TDEL0H02010)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    TDEL_0H02010 (TDEL0H02010)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:tdl01004]
    TDEL_0H02010 (TDEL0H02010)
Enzymes [BR:tdl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     TDEL_0H02010 (TDEL0H02010)
Lipid biosynthesis proteins [BR:tdl01004]
 Fatty acid synthase
  Component type
   TDEL_0H02010 (TDEL0H02010)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N
Motif
Other DBs
NCBI-GeneID: 11501224
NCBI-ProteinID: XP_003683271
UniProt: G8ZZL6
LinkDB All DBs
Position
8:344995..346293
Genome map
AA seq 432 aa AA seqDB search
MIMSRVVITGLGCRTPLGHSVRESWTNLLKGKSGIVPVTGLADYETEFKDVIPKTVTVGK
IPEGSVEPEGLITDQDRRRCANFTRLALLATHEALKGARLLEDDLTVTSGVDLDRFGCII
GSGIGSIQDICSATQTLNNGKKVSPLFVPRILANMAAGNVSIKFNLRGASHCVSTACATG
NNAIGDAYNFIRLGMQDICVAGASESCINPLSLAGFIRAKSINTENGVSRPFDAKRSGFV
LGEGAGIVVLESLESAKKRQAPIIAEVKGYGLSSDAYHITSPSPNGDGARRAMQMALSEV
DHREVGYVNAHATSTLLGDRAESLAIKSTFLQYRTKPLYVSSNKGSIGHLLGAAGAVESI
FTIMALREQIIPHTLNLETVAGAKGDDFDTQFSGIDFVKNQPRRDDELHFAMCNSFGFGG
VNTALLFERWQE
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgatcatgtcgagagttgtgattactgggttgggttgtaggactccgttgggtcactct
gtgcgggaatcatggaccaacctgctcaagggcaagtctggtatagttcctgtcactggg
cttgctgattatgagaccgagtttaaagatgttataccgaagacagtcaccgtaggtaag
attcctgagggctcagtggaaccagagggcttgattacggatcaggatcggagaaggtgt
gcgaattttactaggttggcactcttggctactcatgaagcgttaaagggtgctcgttta
ctcgaggacgatctgacagtcacttctggggtggatctcgataggttcggttgtatcatc
ggatcgggtataggttctattcaagacatttgctcagcgactcagacacttaataatggt
aagaaagtctctccattgtttgttccaagaattctcgccaatatggctgctgggaatgtg
tctatcaaatttaatctacgaggcgcatcccactgtgtatctacagcgtgcgctacgggt
aataatgccatcggggatgcttataactttattcgtctaggtatgcaggatatctgtgtt
gctggagccagtgagtcatgcataaatccgttgagtctcgcagggtttattcgagcaaag
agtattaatacagaaaatggtgtatcaagacctttcgatgccaagagatcagggttcgtt
ctgggtgaaggtgctgggatcgttgtgttggaatcgcttgaaagtgccaagaaacgccaa
gcgccaatcatcgcagaggtcaaaggctacgggttgagtagtgatgcttatcacatcact
tcgccttcaccaaatggtgatggtgctcgtcgtgcaatgcagatggctctctcggaagtt
gaccatcgtgaagttggttacgtcaatgctcatgccacttctacgctacttggcgatcgc
gcagaaagtctcgcaatcaagagtacattcttacagtatcggacgaaaccactttatgtc
tcgagtaacaagggttccattggtcatcttctcggagctgcaggtgcggtagaaagtata
ttcacaatcatggctttaagagagcagataattccccacacgctaaacctggagacggtc
gctggcgccaaaggtgatgatttcgatacccagttcagcgggatcgattttgtcaagaat
cagcctcggcgcgacgacgagctgcattttgcaatgtgtaatagtttcgggttcggtggt
gtaaacacagcattgctctttgaaaggtggcaggaataa

DBGET integrated database retrieval system